Generated by All in One SEO Pro v4.9.5.2, this is an llms-full.txt file, used by LLMs to index the site. # Southern Water and Soil ## Posts ### [Septic Drainfield Repair and Replacement](https://southernsepticanddesign.com/septic-services-blog/septic-drainfield-repair-replacement/) **Published:** February 16, 2014 **Author:** Southern Water Soil **Content:** Southern Water and Soil, Inc., services the Greater Tampa Bay Area including Lutz, Zephyrhills, Wesley Chapel, Odessa, Land O Lakes, and Dade City. SWS specializes in giving the customers options on their septic system repair or replacement. Many drainfield systems can be recovered by jetting the drainfields and installing a time-dosed control panel to an existing mound system. SWS has repaired, replaced, and recovered many drainfield and septic systems. SWS uses Infiltrator Systems products. Infiltrator makes products such as Aquaworx, Infiltrator EQ-36 Chambers, and EQ-36 Low Profile Chambers. Infiltrator also makes septic tanks that are injection molded which are 10 times stronger than the typical rotational molded septic tanks. Therefore, the septic tank is rated for burial up to 48 inches by the Florida Department of Health. If you need concrete tanks SWS uses concrete tanks too. We have installed many septic tanks over the years. One of the main concerns about septic tanks is that the tanks are properly sealed and tested when installed. A water tightness should be completed on every tank that is installed. ![Drain field Replacement](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Drain-field-Replacement.jpg) Sometimes a drainfield replacement is absolutely necessary when roots have taken over the drainfield or the drainfield is too old for drainfield recovery or rejuvenation. A drain field replacement is the only sure way to have a septic system repaired to 100%. SWS has diagnosed and inspected many septic systems to determine the efficacy of septic rejuvenation. ![Clogged Distribution Box](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Clogged-Distribution-Box1.jpg) A clogged distribution box or D-Box can be signs of problems in the drainfield of the septic system. Many times the D-Box will fill up with sludge because there is no filter on the septic tank and the septic tank has not been maintained properly. This can cause the drainfield to fail due to clogging. Many times the septic drainfield can be recovered. However, if the drainfield is too old and the bio-mat is too thick then a recovery is highly unlikely. ![Bio-Mat Under Drainfield](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Bio-Mat-Under-Drainfield1.jpg) In the picture above the bio-mat is the dark layer that formed directly beneath the drainfield. This can grow to be very thick and limit the amount of water that can percolate through the soil. When this occurs it is very difficult to recover the drainfield and multiple drainfield recovery techniques are required to be successful. Sometimes it is inevitable that a drainfield replacement will be required. ![Watertight Riser Package](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Common-Septic-System-Issues2.jpg) Having a watertight access port is very important to the life of the septic system. If a filter is not installed solids can get into the drainfield and cause damage to the system. If the filter is installed and the access port is not sealed properly then you will cause more problems from excess water and sand getting into the septic tank and drainfield. SWS installs septic systems that the homeowner needs. Providing these options to the homeowners is what SWS does. ![Infiltrator EQ36 Low Profile](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Infiltrator-EQ36-Low-Profile1.jpg) If you need estimates on your septic system installation or drainfield repair or replacement then give the septic experts at Southern Water and Soil, Inc., an opportunity to earn your septic repair business. [813-785-0500](tel:+1-813-785-0500). **Categories:** Septic Services Blog --- ### [ATU System with Geoflow Drip Irrigation](https://southernsepticanddesign.com/septic-services-blog/atu-system-with-geoflow-drip-irrigation/) **Published:** March 2, 2014 **Author:** Southern Water Soil **Content:** ![Excavate Old Drainfield](/wp-content/uploads/2015/06/Excavate-Old-Drainfield1.jpg) Proper installation of a drainfield replacement or septic system replacement starts with proper excavation and drainfield sand preparation. In the picture above SWS is completing a septic system replacement. We had to excavate the existing drainfield material and the old septic tank that was there. The drainfield was completely grown in with roots and sand. Once excavated we installed the septic tank (pretreatment tank), the 1000 gallon per day ATU tank, and the 1280 gallon dosing tank. ![Septic and ATU Tank Installation](/wp-content/uploads/2015/06/Septic-and-ATU-Tank-Installation.jpg) It is important to install the septic tanks with proper care. Installation of septic tanks can be quite hazardous. The concrete tanks are quite heavy and proper excavation techniques are required. This is sometimes the hardest part of the job. ![Geoflow Drip Irrigation](/wp-content/uploads/2015/06/Geoflow-Drip-Irrigation1.jpg) In Florida, treatment is required prior to disposal or reuse through drip irrigation. The State of Florida is doing research into the use of septic tank effluent through drip irrigation. North Carolina allows drip disposal with septic tank effluent. Maintenance is easier with pretreated wastewater. Geoflow Drip Systems provide an excellent way to reuse wastewater. When the effluent is pretreated then we can make the drainfield last forever, with proper maintenance. ![Septic Riser and Lids](/wp-content/uploads/2015/06/Septic-Riser-and-Lids1.jpg) Proper maintenance can be completed if the proper access is given. Septic tank risers and lids allow the operator to access the proper components to complete scheduled maintenance procedures. A properly designed and installed ATU system has access built into the system. The picture above shows access ports to important system components. ![Drainfield Cover with Seed and Hay](/wp-content/uploads/2015/06/Drainfield-Cover-with-Seed-and-Hay.jpg) Another often neglected component of the septic system is the established vegetation. We rake down our septic systems then seed and hay to establish vegetative cover over the drainfield area. This promotes soils that are healthy and ready for the reuse water. It also prevents soil erosion from the drainfield area. If you are looking for a properly designed and engineered septic system then call SWS at [813-785-0500](tel:+1-813-785-0500). **Categories:** Septic Services Blog --- ### [Mobile Home Park Septic System Design, Engineer, and Install](https://southernsepticanddesign.com/septic-services-blog/mobile-home-park-septic/) **Published:** February 8, 2015 **Author:** Southern Water Soil **Content:** **Southern Water and Soil, Inc.,** provides innovative and cost effective septic system design, engineering, installation, and maintenance for mobile home park owners and managers. Allow SWS to provide you with complete solutions from A to Z. SWS provides MHP’s with a complete circle of services. Please allow us to work on your septic or wastewater project today! Mobile Home Park Case Studies: ### 9,000 GPD Mobile Home Park Septic System in Tampa, Florida ![DSC00610](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00610.jpg) ![DSC00612](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00612.jpg) ![DSC01190](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC01190.jpg) ![100_1024_000](https://southernsepticanddesign.com/wp-content/uploads/2015/06/100_1024_000.jpg) “I don’t want a mound.” “I don’t want it to take up the entire park.” ” I don’t want to lose the trees that are in the park.” Perhaps disguising or relocating the system can achieve your goals. Drip irrigation is another possibility. Drip irrigation can decrease the footprint of your septic or wastewater disposal system by as much as 70%. SWS has vast experience with drip irrigation systems in Florida. SWS promotes the use of [Geoflow drip irrigation systems](https://southernwatersolutions.com/documents/DripIrrigation.pdf). Geoflow pressure compensating drip irrigation systems contain **ROOTGUARD®** and ***Ultra–Fresh®***. These patented technologies completely solve root intrusion and biological plugging problems for subsurface drip applications. In Florida, drip irrigation can be used after secondary treatment of wastewater. It is a beneficial reuse of water protecting Florida’s precious water sources by returning water to the water cycle near its point of use. ![IMAG0491](https://southernsepticanddesign.com/wp-content/uploads/2015/06/IMAG0491.jpg) ![IMAG0475](https://southernsepticanddesign.com/wp-content/uploads/2015/06/IMAG0475.jpg) ***“I have been told that I need an engineered designed system with low pressure dosing… what does that mean?”*** A low pressure dosing system in Florida has to be designed according to 64E-6 Florida Administrative Code and meet requirements described by the EPA onsite manual. The system has to be designed by a professional engineer that has experience with onsite wastewater systems. ![DSC00176_000](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00176_000.jpg) ![DSC00177-1](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00177-1.jpg) ![engineeredplan](https://southernsepticanddesign.com/wp-content/uploads/2015/06/engineeredplan.jpg) ![100_1023-1](https://southernsepticanddesign.com/wp-content/uploads/2015/06/100_1023-1.jpg) ***“My septic system seems to be sluggish and slow. Does it need to be replaced? If so, is there any way I can save my landscaping?”*** If your drainfield is in failure it cannot take the amount of water or the organic load that is being produced. Time dosing your drainfield with **SWS’s** effluent pumping system can rejuvenate your drainfield without the cost of destroying your landscape or replacing your drainfield. Time dosing allows large volumes of water (i.e., laundry, bathing, dishes, etc.) used to be dosed throughout the entire day instead of at the time of use. Spreading out wastewater dosing can allow more time for your drainfield to recover. The reduction of organic loads to the drainfield is another alternative to replacing your drainfield. SWS can design a treatment system than can reduce organic loading of the drainfield. By reducing the organic loading the infiltrative surfaces inside of your disposal system can be cleaned naturally and the system can continue to function, without the destruction of your landscaping. ![IMAG0616](https://southernsepticanddesign.com/wp-content/uploads/2015/06/IMAG0616.jpg) ![IMAG0615](https://southernsepticanddesign.com/wp-content/uploads/2015/06/IMAG0615.jpg) SEPTIC SYSTEM DRAINFIELD — BIOMAT FORMED UNDERNEATH THE DRAINFIELD PRODUCT — ORGANIC LOADING ***“I heard that septic systems are required to have [effluent filters](https://southernwatersolutions.com/documents/1ResidentialFTHowToSelect.pdf). Is there a difference between filters?”*** Yes, there is a difference between filters. There are two factors that you have to consider when choosing an effluent filter: [Surface Area and Flow Area](https://southernwatersolutions.com/documents/1FilterFacts.pdf). The Surface Area is where the particulates are caught and the Flow Area is the amount of openings that are in the filter allowing the effluent to pass. A large surface area is great, however, if there is nowhere for the effluent to flow then it requires more maintenance. So, flow area is just as important as surface area. SWS can help you determine the correct filter for your application ensuring a filter that peforms without frequent maintenance. Serving Lutz-Tampa, Brandon-Valrico, Zephyrhills-Dade City and all of the Tampa Bay Area with Septic and Wastewater System Services. Serving all of Florida with Septic System Engineering Services. 19007 US Hwy 41; Lutz, FL 33541\* 3433 Lithia Pinecrest Road, Valrico, FL 33596 Phone [813-785-0500](tel:+1-813-785-0500) \* Fax 813-315-7444 Text is ©Copyright Reserved by Southern Water and Soil, Inc. ### Related Posts: [## Commercial Septic System Contractor](https://southernsepticanddesign.com/septic-services-blog/commercial-septic-system-contractor/)[## Common Septic System Issues](https://southernsepticanddesign.com/septic-services-blog/common-septic-system-issues/) **Categories:** Septic Services Blog **Tags:** Septic System --- ### [Community Collection Systems](https://southernsepticanddesign.com/septic-services-blog/community-collection-systems/) **Published:** February 20, 2015 **Author:** Southern Water Soil **Content:** Effluent sewers are becoming recognized as the best solution for collecting and transporting wastewater in small to mid-sized communities, new subdivisions, and environmentally sensitive areas. Effluent sewers are often one-fourth to one-half the cost of conventional gravity sewers. When properly designed, they are easy to install and maintain, they require less costly treatment systems, and their treated effluent can be re-used for irrigation. SWS’s Effluent Sewers feature equipment that is superbly engineered, corrosion resistant, durable, lightweight, and fully warrantied. SWS’s Effluent Sewer packages include both pump collection systems (often called STEP systems) and gravity collection systems (often called STEG systems). Effluent Sewer packages with SWS’s Monitoring System (an affordable, web-based remote telemetry system) are also available. Design assistance for engineers is included. Hundreds of communities across North America are successfully collecting and treating their wastewater with Effluent Sewer Systems. SWS’s collection and treatment systems are permitted through the Florida Department of Environmental Protection and the Florida Department of Health. Please call SWS at [813-785-0500](tel:+1-813-785-0500) for design assistance or to schedule a presentation. You can also contact us for information. ![CommunityWastewaterSystems](https://southernsepticanddesign.com/wp-content/uploads/2015/06/CommunityWastewaterSystems.jpg) This is a 45 pod AX-100 Advantex Treatment System Actual Flow Capacity = 112,500 GPD Design Peak Capacity = 225,000 GPD **Developmental Shift** The dichotomy of comparing big pipe gravity sewer systems with low cost traditional septic systems has been the status quo for the past several decades. However, with emerging technologies and designs there are other methods of disposing of wastewater. There are hybrid systems that need to be examined, whereby, primary treatment can be achieved at the homes and modular and scalable units at the development level can provide treatment. Disposal of the wastewater can be at or near the point of origin thus providing recharge to the local aquifer where the water was taken from. ![clip_image002](https://southernsepticanddesign.com/wp-content/uploads/2015/06/clip_image002.jpg)In Florida, there are perceived problems with using hybrid wastewater treatment systems. Municipal utilities see the use of franchise utilities and the ownership and management of these systems as problems. The alleged problems with franchise utilities in Florida stem from the past use of package plants. In the past, investor owned wastewater (package) plants with franchise utilities were placed into service. These utilities were purely concerned with profit and not the long-term considerations of the community, the environment, or the life cycle costs of upgrading the plant or wastewater collection system. This posed a problem in that these utilities became unprofitable and the municipalities inherited the problem. This problem of “dump and run” can be overcome by looking at long-term life cycle costs of the collection system and treatment system. A life cycle cost analysis can be done whereby, a system is not designed on the cheap, is poorly operated, and money is not planned or provided for future maintenance works or upgrades. A mechanism needs to be in place that ensures the future of the wastewater system. There needs to be accountability for the long-term cost of the wastewater system that is chosen. This can all be done within the existing rate structures of an existing utility or wastewater authority. Southern Water Solutions can offer suggestions for communities that institute Distributed Wastewater Systems (DWS’s): - Institute a distributed wastewater authority that oversees the design, installation, and management of DWS’s (i.e., an existing utility, designated EPA level 5 responsible management entity (RME), etc.) - The wastewater authority or board should oversee the life cycle cost analysis and create a list of treatment systems that are proved for use within their district. - Wastewater treatment monies (i.e., bond issue, community investment, etc.) can be used to provide assurance that the system will not be a burden to the rest of the community. The amount of the money required up front should be based on the systems long-term performance rating and the systems track record. - If bonding is not available, then a distributed wastewater cooperative can pay into a program that provides insurance for the facility. - There are tools that can manage risk, cost, and provide multi-criteria assessments that help decision makers base decisions on criteria of sustainability. These tools enhance the involvement of stakeholders. Providing reasonable assurances to the stakeholders is very important. The EPA has funded grants for the sole purpose of illustrating centralized management of distributed wastewater systems. However, it is difficult to overcome the negative stigma placed on DWS’s. If DWS’s are managed like a centralized municipal sewerage system then responsibility is taken out of the hands of the homeowner or private utility and put into the hands of a responsible management entity (RME) or wastewater authority. It is proven that DWS’s work and work well when properly designed, installed, operated, and maintained. If your community would like a presentation on how you can better implement these ideas please contact Southern Water Solutions by calling us or e-mailing us. **SEWER MINING** Sewer mining is the siphoning, treatment, and re-use of effluent that was destined for the centralized wastewater treatment plant. Savings is not truly realized unless examined more thoroughly. First, additional capacity is provided at the existing wastewater treatment plant, whereby, in-fill projects can be constructed that are closer to the plant. Second, beneficial re-use of the wastewater can be obtained without running millions of dollars of purple pipe to the site. Therefore, reasonable and beneficial re-use is being obtained at the local level (i.e., in parks, soccer fields, etc.) through subsurface drip irrigation. Third, the re-use of the wastewater reduces the amount of potable water being used for irrigational purposes. This results in a direct offset of potable water that would have been used. Please contact your local water management district about funding. It is possible that these types of projects can be used for conservation project funding where matching funds can be used to conserve water near to your project. Through the use of DWS’s many of Florida’s water and wastewater problems can be solved. If your community would like a presentation on how you can better implement these programs please contact Southern Water and Soil by calling us or e-mailing us. Wastewater Treatment: **Textile Filter Technology** SWS’s Treatment Systems are based on packed bed filter technology — a reliable, proven method for treating onsite wastewater. SWS’s engineers have optimized packed bed filter technology over the past 20 years. Instead of using sand or gravel for the filtering media, the SWS product line uses an engineered textile. Textile is much more efficient than sand or gravel because it has about five times more surface area. That’s why, with textile filters, you can treat the same amount of wastewater in a fraction of the space. Text ©Copyright Reserved by Southern Water and Soil, Inc. Photos and text excerpts courtesy of Orenco Systems®, Inc Photos Courtesy of Dauphin Environmental, LLC **Categories:** Septic Services Blog --- ### [Cluster Wastewater Treatment Systems](https://southernsepticanddesign.com/septic-services-blog/cluster-wastewater-treatment-systems/) **Published:** February 26, 2015 **Author:** Southern Water Soil **Content:** **Cost Effective, Environmentally Friendly, Reliable and Proven Wastewater Collection, Treatment, and Reuse for Communities** Cluster Wastewater Treatment Systems are being touted as solutions for many communities. The benefits of clustering homes together is numerous: Open areas are preserved for community use (i.e., farming, soccer fields, community recreation parks, hiking trails, equestrian trails, etc.), stormwater production is reduced, cost of development is reduced, nutrients can be more readily reduced, etc. When wastewater is clustered together it becomes more economically feasible to treat unwanted constituents from the wastewater. Clustered treatment promotes performance reliability and management of nutrient (i.e., Nitrogen species, phosphorus, etc.) reduction. Treatment in general is more economical due to blending effects and having treatment in fewer locations. Instead of having a treatment module at every home the treatment is spread throughout the community into clusters. Having an aeration module to maintain at every home becomes a daunting task for a utility or responsible maintenance entity (RME). The clustering of treatment throughout the community is ideal for the utility or RME for ease of access, maintenance, maintenance frequency, water quality testing, etc. Southern Water Solution’s Wastewater Treatment Systems treat the wastewater to better than secondary treatment standards; however, if more stringent requirements are required within a community then additional treatment can be cost effectively done through clustering. When additional costs are of a concern then cost recoveries can be examined. The added expense of additional treatment requirements can be recovered with an increase in lot density of 10-20%, consequently, neutralizing the additional cost to individual homeowners within the community cluster system. **Benefits of SWS’s Treatment Systems** The use of a textile based treatment system allows the treatment of wastewater in a relatively compact area. This is beneficial for the aesthetics of the community. Here are some benefits of using textile treatment systems. - Does not produce foul odors - No noisy blowers - Does not require extended aeration - Media does not degrade over time like other media - Media does not have to be replaced - Requires up to 95% less energy - Decreases bio-solids production by up to 90% (no sludge) - Compact and modular for easy expansion - Performs in storms, power outages, etc. - Significant reduction in operation and maintenance costs - Virtual elimination of long term repair and replacement that is typical of conventional systems - Encourages and accommodates reuse within the immediate community - Promotes sustainable development - Great for communities, small cities, rural enclaves, agricultural clusters, and commercial development SWS’s collection and treatment systems are permitted through the Florida Department of Environmental Protection and the Florida Department of Health. Please call SWS at [813-785-0500](tel:+1-813-785-0500) for design assistance or to schedule a presentation. You can also contact us for information[.](mailto:info@southernwatersolutions.com) **Categories:** Septic Services Blog --- ### [Engineered Septic Systems](https://southernsepticanddesign.com/septic-services-blog/engineered-septic-systems/) **Published:** March 1, 2015 **Author:** Southern Water Soil **Content:** SEPTIC AND WASTEWATER PROJECTS Multi-Family Work Camp Local farmer needed a treatment system for his work camp. The system needed to be flexible in design and accommodate the entire complex. The system uses fiberglass reinforced polyester (FRP) tanks from Containment Solutions, Inc. The treatment system is an Orenco AdvanTex® Treatment System using AX-100 treatment modules. ![April2007049](https://southernsepticanddesign.com/wp-content/uploads/2015/06/April2007049-300x225.jpg) ![April2007044](https://southernsepticanddesign.com/wp-content/uploads/2015/06/April2007044-300x225.jpg) Design Peak = 44,000 gpd Average Daily = 22,000 gpd Lutz Medical Center Doctors’ office and professional office complex. The owners could not fit the conventional septic system on the lot and accommodate the parking spaces needed, square footage of building, etc. SWS worked with the owners to accommodate an Advantex Treatment System which reduced the size of the footprint to accommodate the existing civil plan. The system includes 24/7 monitoring through control panel. ![100_1114-1](https://southernsepticanddesign.com/wp-content/uploads/2015/06/100_1114-1.jpg) ![LutzMedCenter009](https://southernsepticanddesign.com/wp-content/uploads/2015/06/LutzMedCenter009.jpg) Peak Capacity = 3,000 gpd Average Daily = 1,500 gpd Brownell Hair Salon An AdvanTex Treatment System replaced a conventional septic system that was exceeding design capacity and had failed a few times in the past few years. The system had limited space for repair. Tankage was placed in parking lot and Biotube Filters in series were placed in the primary treatment. A 3 Pod AX-20 AdvanTex Treatment System was added to the system. SWS worked with the installer and owner to alleviate problems with repeat failures and space constraints. ![DSC00464](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00464.jpg) ![DSC00463](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00463.jpg) ![BrownellSalonProject3AX20012](https://southernsepticanddesign.com/wp-content/uploads/2015/06/BrownellSalonProject3AX20012.jpg) ![BrownellSalonProject3AX20010](https://southernsepticanddesign.com/wp-content/uploads/2015/06/BrownellSalonProject3AX20010.jpg) Design Capacity = 3,000 gpd Actual Flows = 1,300 gpd Carol and Ron’s MHP Low pressure dosing system designed for mobile home park. The owners were having problems getting a design to accomodate their mobile home park. The system was nestled into the project even with high watertables. Orenco ProSTEP pump package provided the needed dynamic head and gallons per minute required by the system configuration. ![DSC00178-1](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00178-1.jpg) ![DSC00176-1](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00176-1.jpg) Design Capacity = 3,400 gpd Lutz Residential System Aesthetics and Green Principles led to the use of an Advanced Treatment System for this home. The owners wanted a system that would provide supplemental irrigation for their landscaping. The system was designed with AdvanTex Treatment and Geoflow Subsurface Drip Irrigation. ![DSC00473-1](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00473-1.jpg) ![DSC00471-1](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00471-1.jpg) Daycare Facility in Lutz, FL The owner of this property could not fit the building, parking lot, and septic system on their lot. However, with the use of the Advantex Treatment System the owners were able to make the lot buildable. The design implemented reduced the footprint of the wastewater system by 65% from a conventional septic tank and drainfield system. The owners wanted a system that would provide supplemental irrigation for their landscaping. The system was designed with AdvanTex Treatment and Geoflow Subsurface Drip Irrigation. ![March07032](https://southernsepticanddesign.com/wp-content/uploads/2015/06/March07032.jpg) ![May2007152](https://southernsepticanddesign.com/wp-content/uploads/2015/06/May2007152.jpg) Design Capacity = 3,500 gpd Carpet and Tile Retail Center in Ruskin, FL The owner of this property could not fit the building, parking lot, and septic system on their lot. However, with the use of the Advantex Treatment System the owners were able to make the lot buildable. The design implemented reduced the footprint of the wastewater system by 65% from a conventional septic tank and drainfield system. The owners wanted a system that would provide supplemental irrigation for their landscaping. The system was designed with AdvanTex Treatment and Geoflow Subsurface Drip Irrigation. ![April2007055](https://southernsepticanddesign.com/wp-content/uploads/2015/06/April2007055.jpg) ![April2007054](https://southernsepticanddesign.com/wp-content/uploads/2015/06/April2007054.jpg) Design Capacity = 500 gpd Commercial Retail Center Septic System in Tampa, FL The owner of this property could not fit the building, parking lot, and septic system on their lot. However, with the use of PTI Multi Pipe the owners were able to make the lot buildable. The design implemented reduced the footprint of the wastewater system by 33% from a conventional septic tank and drainfield system using rock and pipe. The system was designed with low pressure dosing. ![commercialconstruction_000](https://southernsepticanddesign.com/wp-content/uploads/2015/06/commercialconstruction_000.jpg) ![Dino2](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Dino2.jpg) Design Capacity = 1,600 gpd Serving Lutz-Tampa, Brandon-Valrico, Zephyrhills-Dade City and all of the Tampa Bay Area with Septic and Wastewater System Services. Serving all of Florida with Septic System Engineering Services. We have worked on many septic and wastewater projects throughout Florida. In the Tampa FL area, SWS provides its clients with complete septic and wastewater services from engineering and permitting to installation and maintenance. 19007 US Hwy 41; Lutz, FL 33541\* 3433 Lithia Pinecrest Road, Valrico, FL 33596 Phone [813-785-0500](tel:+1-813-785-0500) \* Fax 813-315-7444 **Categories:** Septic Services Blog --- ### [The Septic Experts](https://southernsepticanddesign.com/septic-services-blog/the-septic-experts/) **Published:** March 1, 2015 **Author:** Southern Water Soil **Content:** If you are having **septic problems** and you are looking for septic solutions then you have come to the right place! Septic problems can be so frustrating. We understand your dilemma. We are here to help you put things back in order. Allow the staff at SWS help you with your septic problem. SWS has the septic know-how. There is something to be said about experience, Southern Water and Soil is led by Greg Mayfield, RS, RSTC, CEHP. Greg is a former Hillsborough County Health Department septic tank inspector. Greg is a graduate at the University of South Florida and leads a staff that is cross trained and well rounded to help with any septic issue. SWS strives to provide comprehensive,individualized, and complete solutions for each of our customers. Water is one of our world’s most important, and vulnerable natural resources. Through the use of our innovative ideas and products, we provide Florida home owners and business owners with septic and wastewater solutions for their needs. Our solutions are innovative and cost effective. ![Septic Repair in Brandon, Florida](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Septic-Repair-in-Brandon-Florida.jpg) By combining solid science, education and past work experience from the Department Of Health, Department of Environmental Protection, and Southwest Florida Water Management District, SWS can provide a unique and perspective for our customers’ septic and wastewater needs. Whether those needs are for an individual homeowner, new development or existing community, or for commercial applications we are prepared and eager to assist you in any way possible. **We at Southern Water and Soil provide:** - **septic problems diagnoses** - ****septic system installation services**** - **septic system engineering services** - **permit application services** - **septic and aerobic system maintenance** - **septic system warranty packages** We have worked on many septic and wastewater projects throughout Florida. SWS provides its clients with complete septic and wastewater services from engineering and permitting to installation and maintenance. **Call today to inquire about our services and free estimates!** **Statewide:[1-866-797-7645](tel:+1-866-797-7645)**/ **Tampa: [813-785-0500](tel:+1-813-785-0500)** ### Related Posts: [## Septic Rejuvenation](https://southernsepticanddesign.com/septic-services-blog/septic-rejuvenation/)[## Septic Design and Engineering](https://southernsepticanddesign.com/septic-services-blog/septic-design-and-engineering/) **Categories:** Septic Services Blog **Tags:** Septic --- ### [How to Avoid Septic Problems: Septic System Information in Tampa, Florida](https://southernsepticanddesign.com/septic-services-blog/avoid-septic-problems/) **Published:** October 22, 2013 **Author:** Southern Water Soil **Content:** ![Greg and Tanya Mayfield](/wp-content/uploads/2015/06/weavermayfield-39.jpg)Do you have a healthy septic system? Do you know what steps to take to avoid costly repairs? The key to avoiding costly repairs is preventative septic maintenance. The old saying if it’s not broke don’t fix it does not apply here. The average septic system should last anywhere between 20-30 years, if maintained properly. Unfortunately, most homeowners neglect septic system maintenance, leading to early replacement of drain fields and septic systems, and in turn costly repairs and replacements years before it’s due. For example, it typically costs several thousand dollars to replace a failing septic system, compared to a few hundred dollars per year to have a septic system routinely pumped and/or inspected. All of the above can be prevented with regular maintenance and inspections by licensed, certified technicians. If the homeowner neglects regular maintenance, they are likely to face thousands of dollars of repair and complete system failure. Homeowners looking for quality [septic maintenance ](https://www.sw-soil.com/2012/02/13/5-quick-tips-for-keeping-your-septic-system-working-properly-in-the-tampa-bay-area/ "5 Quick Tips for Keeping Your Septic System Working Properly in the Tampa Bay Area")in the Tampa Bay area, look no further than Southern Water and Soil Septic System Experts. Greg Mayfield, has 17 years of experience. He and his team are the most trusted experts in the field of septic/[onsite wastewater treatment ](https://www.sw-soil.com/engineered-septic/package-wastewater-treatment-system-installation/ "Package Wastewater Treatment System Installation")and subsurface disposal systems. Homeowners can take the following steps to avoid costly repairs. 1. Get inspected. [Septic systems should be inspected](https://www.sw-soil.com/2013/04/05/is-septic-contractor-your-fully-trained/ "Is Your Septic Contractor Fully Trained") every 1-2 years, and more frequently if the system has had issues in the past. Regular inspections will help catch potentially bigger issues, which can lead to costly repairs later down the road. Most septic companies offer annual inspections as part of their annual service programs. Speak to your Southern Water representative today to schedule your appointment for a healthy septic system. ![Clogged Effluent Filter1](/wp-content/uploads/2015/06/Clogged-Effluent-Filter1.jpg) 2. Get Pumped. According to the EPA most [septic systems need to be pumped](https://www.sw-soil.com/2013/03/28/septic-company-in-tampa/ "Septic Company in Tampa") every 1-3 years. It is important to hire a licensed trusted professional to inspect your septic system. Greg Mayfield, owner of Southern Water has years of expertise and can help determine what schedule and how often your system should be pumped. There are many factors, that can lead require a system to be pumped more often. If you have a garbage disposal, for example, you will have to pump out your system more frequently than persons disposing of their food waste in a garbage can or by other means. It is extremely important hire a trusted septic system inspection and service provider to ensure you don’t pump too often. Over-pumping can also be harmful to the natural bacteria and process of your septic system. ![Excessive Water Use](/wp-content/uploads/2015/06/Excessive-Water-Use1.jpg) 3. Water control- Generally speaking, the more people in a household, the more water used, the more water that flows thru the system. Consider low-flow toilets and fix leaky faucets. Direct all waste water into the septic system. Do not drive or park over your system. Avoid harmful chemicals for cleaning. Consider spacing laundry throughout the week, instead of 3-4 loads on one day to avoid stressing your system. Keep roof drains and rainwater direct away from your absorption field. Avoid planting trees near your septic system, to avoid roots growing and causing potential blockages. Inadequate filtering of waste water can have potentially serious health effects to your family and your neighbors. Bacteria and viruses from human waste can cause dysentery, hepatitis, and typhoid fever. Many serious outbreaks of these diseases have been caused by contaminated drinking water. Ask us about our[ timed dosed control panels](https://www.sw-soil.com/engineered-septic/engineered-septic-systems/ "Engineered Septic Systems") that help discover water leaks and rain water intrusion. ![Bio-Mat Under Drainfield](/wp-content/uploads/2015/06/Bio-Mat-Under-Drainfield1.jpg) 4. Know what can go- Homeowners can educate themselves on what can and cannot be flushed in the toilet. Understanding what your septic system can handle will prolong the life and help maintain a healthy system. Do not put disposable diapers, sanitary napkins,tampons, condoms, paper towels, facial tissues, plastics, cat litter, or cigarettes into your septic system. These items are more solid and will cause your system to need to be pumped more often. Also clients living in coastal areas should avoid having down spouts that put excess water over the [drainfield ](https://www.sw-soil.com/residential-septic/drainfield-replacement-and-repair/ "Drainfield Replacement and Repair")area. ![Coffee Grounds on Filter1](/wp-content/uploads/2015/06/Coffee-Grounds-on-Filter1.jpg) For more information about preventative septic maintenance or to sign up for annual septic system maintenance in the Tampa Bay area, call Southern water and Soil experts. **Categories:** Septic Services Blog --- ### [Your Complete Guide to Septic System Inspections in Florida: What Contractors and Property Owners Need to Know](https://southernsepticanddesign.com/septic-services-blog/your-complete-guide-to-septic-system-inspections-in-florida-what-contractors-and-property-owners-need-to-know/) **Published:** September 4, 2025 **Author:** Southern Water Soil **Content:** The septic inspection landscape in Florida has undergone a significant transformation, creating new opportunities and streamlined processes for contractors, builders, and property owners alike. With recent regulatory changes and the introduction of Private Provider Inspections (PPIs), understanding the full scope of septic inspection services has never been more critical for industry professionals and property owners navigating Florida’s evolving requirements. ### The Changing Face of Septic System Inspections: Understanding PPI ![Your Complete Guide to Septic System Inspections in Florida: What Contractors and Property Owners Need to Know](/wp-content/uploads/2025/09/2011-10-25-13.24.35-res.jpg)Florida’s septic inspection industry underwent a pivotal shift with the enactment of legislation that took effect on July 1, 2022. This change introduced Private Provider Inspections (PPIs) of Onsite Sewage Treatment and Disposal Systems (OSTDS) – the official term for septic systems. Previously, all [septic system inspections](/septic-inspections-tampa-fl/septic-system-inspections/) in Florida were exclusively conducted by state or county health department inspectors, often creating bottlenecks and delays for contractors and property owners working on tight project timelines. Now, property owners and their authorized contractors have the option to hire qualified private providers to perform these critical inspections. This regulatory evolution represents a significant opportunity for the industry, as the state board of health strategically offloads this important quality measure to licensed professionals, creating an uptick in demand for septic system inspections while maintaining rigorous standards. For contractors and builders, this means greater flexibility in project scheduling and the ability to work with trusted inspection partners who understand the nuances of their specific projects and timelines. ### Who Benefits from Professional Septic Inspection Services? - **Contractors and Builders –** When installing new septic systems or conducting repairs and modifications to existing systems, inspections are mandatory to ensure compliance with all state and local regulations. Private providers offer a convenient and often faster alternative to waiting for government inspectors, allowing projects to maintain momentum and meet critical deadlines. - **Real Estate Professionals and Those Involved in Property Transactions –** Septic system inspections have become a critical component of real estate transactions, particularly given that failing systems can cost tens of thousands of dollars to repair or replace. For properties in rural areas or those not connected to municipal sewer systems, a comprehensive septic inspection provides essential peace of mind for both buyers and sellers. Many lenders, particularly those offering FHA loans, now require septic system inspections as part of their due diligence process. - **Property Owners and Maintenance Professionals –** The Florida Department of Health recommends regular septic system inspections every 3-5 years for conventional systems. Private providers can perform these routine maintenance inspections to ensure systems function properly and identify potential issues before they escalate into major, costly problems. ### What Does a PPI Septic Inspection Entail? A Private Provider Inspection represents the gold standard in septic system evaluation, encompassing a thorough assessment of the entire system infrastructure. Our PPI services include: - **Tank Inspection:** Our inspectors locate, uncover, and pump out septic tanks to assess their structural integrity, identify any cracks or leaks, and verify that all components, including baffles and filters, function correctly. - **Drainfield Evaluation:** We perform a comprehensive assessment that involves determining drainfield location and size, checking for failure indicators such as standing water, sewage odors, or unusually lush vegetation, and confirming proper functionality. - **Component Testing:** All critical system components, including pumps, alarms, and float switches, undergo thorough testing to ensure optimal performance and reliability. - **Detailed Reporting:** We create comprehensive reports that document all findings, which are then submitted to the appropriate state agencies – either the Florida Department of Environmental Protection or the county’s Department of Health. These reports are crucial for demonstrating regulatory compliance. It’s essential to note that PPIs cannot inspect systems they or their companies have installed, thereby ensuring objectivity and avoiding conflicts of interest. Property owners are responsible for verifying the qualifications of private providers. ### Comprehensive Inspection Services: What to Expect ![Your Complete Guide to Septic System Inspections in Florida: What Contractors and Property Owners Need to Know](/wp-content/uploads/2025/09/2013-02-15-16.58.59-res.jpg)Our [professional septic system inspections](/septic-inspections-tampa-fl/septic-system-inspections/) encompass three primary categories, each designed to meet specific needs and regulatory requirements: 1. **Residential Basic Inspections –** These foundational inspections are ideal when you need to locate a system and conduct a basic visual assessment. The service includes estimating tank size and volume, assessing drain field dimensions, and providing a detailed septic system report card documenting all inspection findings. This level of inspection is often sufficient for basic property assessments or initial evaluations. 2. **Residential Enhanced Inspections –** For more detailed system analysis, our enhanced inspections provide a comprehensive evaluation through advanced diagnostic techniques. These inspections include complete septic system pump-outs, camera inspections of both the septic tank and drain field, precise measurements of tank size and volume, detailed drain field functionality assessments, and thorough written reports documenting the overall state of both the system and drain field. 3. **Commercial Septic System Inspections –** Explicitly designed for septic and building contractors requiring initial or final onsite inspections, these services include expert advice on septic equipment selection, equipment repair, and installation recommendations based on property size, use, and type, as well as comprehensive compliance verification. Please note that commercial inspections require specific project documentation and details before the commencement of the inspection. ### Design and Engineering Services: Complete System Solutions Beyond inspections, our comprehensive septic service providers offer design and engineering services for new construction, redevelopment, or rezoning projects requiring septic system design and engineering. These services ensure all systems meet local installation codes while optimizing performance for specific site conditions and usage requirements. Professional design and engineering services are particularly valuable for contractors working on complex commercial projects or challenging residential sites where standard systems may not be appropriate. ### The Strategic Advantage of Professional Partnerships As Florida’s septic inspection requirements become more sophisticated and the PPI system creates new opportunities, establishing relationships with qualified inspection professionals becomes increasingly valuable. For contractors and builders, working with experienced inspection providers like us offers several strategic advantages, including streamlined project timelines, consistent quality standards, comprehensive documentation for regulatory compliance, and expert consultation on system design and optimization. The evolution of Florida’s septic inspection landscape represents both an opportunity and a responsibility for industry professionals, and we take our role seriously. As the state transitions toward greater reliance on private providers, the demand for qualified, experienced inspection services will continue to grow. Understanding these changes and their implications enables contractors, builders, and property owners to navigate Florida’s septic requirements effectively while upholding the highest standards of environmental protection and public health. Whether you’re managing a large commercial development, installing residential systems, or maintaining your existing systems, comprehensive septic inspection services provide the expertise and documentation necessary to ensure compliance, optimize performance, and protect your investment in Florida’s evolving regulatory environment. ### Related Posts: [## Everything You Need to Know About Our Septic System Inspections \[infographic\]](https://southernsepticanddesign.com/septic-services-blog/everything-you-need-to-know-about-our-septic-system-inspections-infographic/)[## Buying a New Property for Your Business? Don’t Forget About Septic System Inspections](https://southernsepticanddesign.com/septic-services-blog/buying-a-new-property-for-your-business-dont-forget-about-septic-system-inspections/) **Categories:** Septic Services Blog **Tags:** septic system inspections --- ### [Does Your Commercial Septic System Design Meet Your Requirements?](https://southernsepticanddesign.com/septic-services-blog/does-your-commercial-septic-system-design-meet-your-requirements/) **Published:** November 15, 2018 **Author:** Southern Water Soil **Content:** ![Commercial Septic System Design](/wp-content/uploads/2018/11/iStock-950638124_res.jpg) We all know that moment when we need a “fixer” – someone who knows how to solve a problem that doesn’t have an easy solution or that requires expertise. Even the best plans can sometimes lead to unexpected problems that require unique solutions – and that often rings true for commercial business owners. At Southern Water and Soil, we often find that [commercial septic system design](/commercial-septic-lutz-fl/commercial-septic-system-design/) eludes many septic companies, although they certainly try to get it right. If you are finding that your current commercial septic system is not working for your business, then you can call us as your “fixer” for any commercial septic problems you are experiencing. Not only does commercial septic system design require the use of the proper type of system, but your commercial septic company needs to know how to [lay out and install the equipment based on the property size](/commercial-septic-lutz-fl/), soil type, slope of the land, and your business’ intended usage. If any one of these things is not addressed in the early planning stages, your business may be set up for septic failure from the get-go. Fortunately, you can always rely on us at Southern Water and Soil to provide complete solutions when it comes to commercial septic system design, even if it means cleaning up after the company before us. We always act with integrity and professionalism and ensure that you don’t experience any further hassles from this important wastewater management system. [Contact us](/contact-southern-water-and-soil/) today to learn more about our services and to schedule a site evaluation. ### Related Posts: [## Get the Right System When You Choose the Right Commercial Septic System Design](https://southernsepticanddesign.com/septic-services-blog/get-the-right-system-when-you-choose-the-right-commercial-septic-system-design/)[## 3 Factors that Can Affect Your Commercial Septic System Design](https://southernsepticanddesign.com/septic-services-blog/3-factors-that-can-affect-your-commercial-septic-system-design/) **Categories:** Septic Services Blog **Tags:** Commercial Septic System Design --- ### [How Distributed Wastewater Treatment Systems Can Mitigate Future Sewer Overflow Disasters](https://southernsepticanddesign.com/septic-services-blog/how-distributed-wastewater-treatment-systems-can-mitigate-future-sewer-overflow-disasters/) **Published:** April 4, 2025 **Author:** Southern Water Soil **Content:** ### Florida’s Major Sewer Overflow Disasters: The Need for Immediate Action with Distributed Wastewater Treatment Systems Florida’s wastewater infrastructure challenges are not just theoretical; they manifest in devastating overflows that pollute waterways, harm ecosystems, and pose public health risks. Across the state, municipalities have struggled with massive sewer spills caused by aging infrastructure, inflow and infiltration (I&I), and extreme weather events. This follow-up explores some of the largest and most impactful sewer overflows in Florida and underscores the urgent need for innovative solutions. ![How Distributed Wastewater Treatment Systems Can Mitigate Future Sewer Overflow Disasters](/wp-content/uploads/2025/04/iStock-684764482res.jpg) ### Major Sewer Overflows in Florida 1. **Tampa Bay Region** Tampa and Hillsborough County have faced numerous sewer overflows in recent years. During Hurricane Hermine in 2016, Tampa Bay was inundated with over 150 million gallons of untreated and partially treated sewage. Heavy rains overwhelmed the sewer systems, leading to discharges directly into Tampa Bay and nearby waterways. In 2020, the city of Tampa reported a 5-million-gallon spill of untreated wastewater caused by a combination of aging infrastructure and heavy rain. These events underscore the vulnerabilities in the region’s wastewater management systems. 2. **St. Johns River Basin** The St. Johns River, one of Florida’s most iconic waterways, has suffered significant pollution from sewer overflows. In 2021, Jacksonville experienced a series of spills during heavy rain events, discharging millions of gallons of wastewater into tributaries of the river. These spills not only degrade water quality but also contribute to harmful algal blooms, threatening the health of the river’s ecosystems and reducing its recreational and economic value. 3. **Miami-Dade County** Miami-Dade’s wastewater infrastructure, much of it built in the mid-20th century, has struggled to keep pace with the county’s rapid growth and rising sea levels. In 2020, the region reported over 20 million gallons of sewage overflow due to infrastructure failures and inflow from storm surges. Miami’s Biscayne Bay has been particularly affected, with nutrient-rich wastewater fueling algae blooms that have caused significant fish kills and ecological damage. 4. **Fort Myers and Lee County** Fort Myers and surrounding Lee County have also experienced severe sewer overflows. During Hurricane Irma in 2017, Lee County reported over 8 million gallons of sewage spills, much of which ended up in the Caloosahatchee River. These spills exacerbated water quality issues in the region, contributing to red tide events that have plagued Southwest Florida’s coastline. ### The Cumulative Impact While individual spills are alarming, the cumulative effect of these overflows is devastating. Florida’s waterways are under constant pressure from untreated wastewater, leading to long-term damage to ecosystems, reduced property values, and public health crises. ### The Path Forward To address these challenges, municipalities must invest in infrastructure upgrades and embrace innovative solutions, such as distributed wastewater treatment systems. At Southern Water and Soil, Inc., we are at the forefront of providing engineered wastewater solutions tailored to Florida’s unique challenges. Our expertise includes the following: - **Decentralized Treatment Systems:** Scalable systems that reduce reliance on overburdened municipal plants. - **Inflow and Infiltration Mitigation:** Advanced technologies to identify and repair leaky sewer pipes. - **Custom Wastewater Engineering:** Solutions designed to prevent spills, even during extreme weather events. ### Time to Act Florida’s major sewer overflows highlight the urgency of addressing the state’s wastewater infrastructure crisis. By investing in forward-thinking solutions and collaborating with experts like our team, Florida can protect its waterways, preserve its ecosystems, and ensure a healthier future for its residents. For more information on how we can help prevent sewer overflows in your community, contact us today. Together, we can work toward sustainable wastewater management and safeguard Florida’s natural resources for generations to come. **Categories:** Septic Services Blog --- ### [A Decentralized Solution: Distributed Wastewater Treatment Systems](https://southernsepticanddesign.com/septic-services-blog/a-decentralized-solution-distributed-wastewater-treatment-systems/) **Published:** March 21, 2025 **Author:** Southern Water Soil **Content:** ### The Overflow Crisis: Tackling Florida’s Municipal Wastewater Treatment Challenges Florida’s pristine waterways are under siege. Each year, millions of gallons of untreated or partially treated wastewater spill into rivers, lakes, and coastal waters due to aging and overwhelmed municipal wastewater treatment systems. These spills not only jeopardize the state’s natural beauty but also pose significant health and environmental risks. ![A Decentralized Solution: Distributed Wastewater Treatment Systems](/wp-content/uploads/2025/03/2015-08-24-09.35.17-res.jpg) ### The Infrastructure Crisis The root of Florida’s wastewater problem lies in its aging infrastructure. Municipal wastewater treatment plants are designed to handle specific volumes of wastewater. However, leaky sewer pipes—compounded by Florida’s heavy rainfall and rising groundwater levels—introduce excessive amounts of water into the system. Known as inflow and infiltration (I&I), this additional water overwhelms the treatment plants, leading to frequent overflows. When these systems fail, billions of gallons of raw or partially treated sewage are discharged into Florida’s waterways, harming marine ecosystems, endangering public health, and prompting costly cleanup efforts. The consequences are stark: - **Harmful Algal Blooms:** Excessive nutrients from untreated wastewater fuel algal blooms, which deplete oxygen levels and devastate aquatic life. - **Health Hazards:** Pathogens in untreated wastewater increase the risk of waterborne diseases for humans and wildlife. - **Economic Losses:** Water pollution impacts Florida’s tourism and fishing industries, key drivers of the state’s economy. ### A Decentralized Solution: Distributed Wastewater Treatment Systems One promising solution to mitigate the crisis is [distributed wastewater treatment systems](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/). Unlike traditional centralized systems, distributed systems treat wastewater closer to its source. This approach offers several benefits: 1. **Reduced Stress on Municipal Plants:** By treating wastewater locally, distributed systems alleviate the burden on aging centralized facilities. 2. **Scalable Solutions:** These systems can be tailored to meet the needs of growing communities without requiring massive infrastructure overhauls. 3. **Improved Resilience:** Distributed systems reduce the risk of catastrophic overflows during heavy rainfall events. Our company, Southern Water and Soil, Inc., has emerged as a leader in designing and [implementing engineered distributed wastewater treatment systems](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/). ### Engineered Solutions for a Sustainable Future At Southern Water and Soil, Inc., we provide innovative wastewater treatment solutions to help communities and businesses address the challenges of failing infrastructure. Our team specializes in the following: - **Advanced Treatment Systems:** We design systems that efficiently remove nutrients and pathogens, protecting Florida’s waterways from pollution. - **I&I Mitigation:** By identifying and addressing leaky sewer pipes, we help reduce the volume of excess water entering municipal plants. - **Custom Solutions:** From small developments to large-scale applications, we tailor wastewater systems to meet specific needs. ### Related Posts: [## Unlocking Economic Potential: The Case for Distributed Wastewater Treatment Systems in Florida](https://southernsepticanddesign.com/septic-services-blog/unlocking-economic-potential-the-case-for-distributed-wastewater-treatment-systems-in-florida/)[## The Role of Distributed Wastewater Treatment Systems in Florida’s Septic to Sewer Projects](https://southernsepticanddesign.com/septic-services-blog/the-role-of-distributed-wastewater-treatment-systems-in-floridas-septic-to-sewer-projects/) **Categories:** Septic Services Blog **Tags:** Distributed Wastewater Treatment Systems --- ### [Unlocking Economic Potential: The Case for Distributed Wastewater Treatment Systems in Florida](https://southernsepticanddesign.com/septic-services-blog/unlocking-economic-potential-the-case-for-distributed-wastewater-treatment-systems-in-florida/) **Published:** February 4, 2025 **Author:** Southern Water Soil **Content:** As Florida continues to experience rapid population growth and urban development, the need for innovative and cost-effective wastewater management solutions has never been greater. Distributed Wastewater Treatment Units (DWTUs) offer a modern, scalable alternative to traditional centralized systems, providing a range of economic benefits that can appeal to developers, policymakers, engineering firms, and homeowner associations alike. ![Unlocking Economic Potential: The Case for Distributed Wastewater Treatment Systems in Florida](/wp-content/uploads/2025/01/20140109_112312-res.jpg) Here’s why distributed wastewater treatment systems are not just an environmentally friendly choice but also a smart economic investment for Florida’s future. ### 1. Lower Infrastructure Costs Traditional centralized wastewater systems require extensive underground piping, pumping stations, and large-scale treatment facilities, which can represent a significant upfront investment. In contrast, DWTUs eliminate much of this expense by treating wastewater on-site or near the source. This approach dramatically reduces the need for large-scale infrastructure, lowering initial development costs for developers and municipalities. For new communities or infill developments in areas where centralized systems are unavailable or costly to extend, [distributed wastewater treatment systems offer a financially viable alternative](/commercial-septic-florida/distributed-wastewater-treatment-systems/). ### 2. Scalable Solutions for Growing Communities Florida is one of the fastest-growing states in the U.S., with an increasing demand for residential and commercial development. DWTUs are inherently modular, allowing developers to scale wastewater solutions alongside community growth. Instead of overbuilding centralized systems that may take years to fully utilize, DWTUs can be deployed incrementally, matching capacity to actual demand. This scalability minimizes wasted resources and ensures developers can allocate funds more effectively. ### 3. Operational Savings While centralized wastewater treatment plants can be expensive to maintain and operate, DWTUs are designed to be cost-efficient: - **Energy Efficiency:** Advanced distributed wastewater treatment systems consume less energy per gallon treated compared to traditional centralized plants. - **Simplified Maintenance:** Routine maintenance for DWTUs is localized and often less complex, reducing ongoing operational costs. For municipalities and homeowner associations, these savings translate into lower utility bills and more predictable budgeting for wastewater management. ### 4. Resilience and Risk Mitigation Florida’s unique geography—characterized by low elevation, porous limestone bedrock, and vulnerability to flooding—makes centralized wastewater systems more prone to overflows and failures. Such events can lead to costly fines, lawsuits, and environmental remediation expenses. DWTUs, by contrast, offer a decentralized approach that minimizes the risk of catastrophic failures. By distributing treatment capacity across multiple smaller units, communities are better protected against costly disruptions, ensuring a reliable and resilient wastewater infrastructure. ### 5. Enhanced Property Value and Marketability For developers, installing DWTUs can directly enhance the marketability of a project. Modern DWTUs are discreet and can be seamlessly integrated into the landscape, preserving the aesthetic appeal of residential or commercial properties. Moreover, environmentally conscious buyers and investors increasingly seek developments that prioritize sustainability. Highlighting the use of innovative DWTUs as a green infrastructure feature can attract a premium market segment while adding long-term value to the property. ### 6. Leveraging Incentives and Grants Florida offers various financial incentives to promote sustainable development, including grants, tax credits, and low-interest loans for environmentally friendly projects. Developers and municipalities implementing DWTUs can often take advantage of these programs to offset initial costs. Additionally, Florida’s focus on protecting sensitive ecosystems such as wetlands and aquifers makes DWTUs a favorable option for meeting stringent regulatory requirements without incurring costly penalties. ### 7. Job Creation and Economic Growth Investing in DWTUs doesn’t just save money—it stimulates economic activity. The design, manufacturing, installation, and maintenance of decentralized systems create local jobs and drive innovation in wastewater technology. By fostering a robust industry around DWTUs, Florida can position itself as a national leader in decentralized wastewater solutions, attracting additional investment and expertise to the state. ### A Path to Economic and Environmental Harmony [Distributed wastewater treatment systems](/commercial-septic-florida/distributed-wastewater-treatment-systems/) represent an opportunity to align Florida’s economic goals with its environmental responsibilities. By reducing infrastructure costs, enabling scalable development, and delivering operational savings, DWTUs offer a compelling value proposition for stakeholders across the state. For Florida’s developers, policymakers, engineering firms, and homeowner associations, the choice is clear: investing in DWTUs is not only a commitment to sustainable development but also a strategic move toward economic efficiency and resilience. Let’s embrace the future of wastewater management and unlock the full potential of DWTUs to build a more prosperous and sustainable Florida. ### Related Posts: [## A Decentralized Solution: Distributed Wastewater Treatment Systems](https://southernsepticanddesign.com/septic-services-blog/a-decentralized-solution-distributed-wastewater-treatment-systems/)[## The Role of Distributed Wastewater Treatment Systems in Florida’s Septic to Sewer Projects](https://southernsepticanddesign.com/septic-services-blog/the-role-of-distributed-wastewater-treatment-systems-in-floridas-septic-to-sewer-projects/) **Categories:** Septic Services Blog **Tags:** Distributed Wastewater Treatment Systems --- ### [The Role of Distributed Wastewater Treatment Systems in Florida’s Septic to Sewer Projects](https://southernsepticanddesign.com/septic-services-blog/the-role-of-distributed-wastewater-treatment-systems-in-floridas-septic-to-sewer-projects/) **Published:** January 3, 2025 **Author:** Southern Water Soil **Content:** Florida is at the forefront of a significant transformation in wastewater management, fueled by the state’s initiative to address aging infrastructure and safeguard its delicate ecosystems. With substantial funding allocated to septic-to-sewer projects, a promising and innovative solution has emerged—Distributed Wastewater Treatment Units (DWTUs). [Distributed Wastewater Treatment Systems offer a cost-effective and environmentally sustainable approach](/commercial-septic-florida/distributed-wastewater-treatment-systems/) to addressing the state’s wastewater challenges. ![The Role of Distributed Wastewater Treatment Systems in Florida’s Septic to Sewer Projects](/wp-content/uploads/2024/12/1013161020b-res1.jpg) Distributed Wastewater Treatment Systems are an essential component of Florida’s evolving wastewater strategy. Centralized municipal wastewater treatment plants, often operating at or beyond capacity, struggle to keep pace with increasing population demands. Additionally, many septic systems across the state have outlived their lifespan, contributing excess nitrogen to groundwater and threatening Florida’s springs, rivers, and estuaries. ### Why DWTUs? Unlike traditional centralized systems, DWTUs provide decentralized wastewater treatment solutions designed to fit specific community needs. These units can be strategically deployed in areas where connecting to centralized sewer systems is either too costly or logistically unfeasible. By reducing nitrogen pollution and improving water quality, DWTUs play a critical role in protecting Florida’s natural resources while alleviating the burden on overtaxed municipal systems. ### Engineered Solutions with Southern Water Distribution and Southern Water and Soil, Inc. The success of integrating DWTUs into Florida’s infrastructure depends on innovative engineering and expert implementation. Southern Water Distribution and Southern Water and Soil, Inc. are proud to partner in leading this charge. Combining decades of experience in wastewater engineering, permitting, and installation, these companies provide tailored solutions that ensure [Distributed Wastewater Treatment Systems](/commercial-septic-florida/distributed-wastewater-treatment-systems/) meet regulatory requirements while optimizing cost-efficiency. Southern Water and Soil, Inc. specializes in engineering advanced treatment systems designed to reduce nitrogen levels and improve groundwater quality. Their expertise ensures DWTUs are not only effective but also seamlessly integrated into existing infrastructure. Southern Water Distribution, leveraging its robust network and distribution capabilities, provides the essential materials and support to deliver these solutions across Florida. ### A Path Toward Sustainable Growth As Florida continues to grow, addressing wastewater challenges is critical to preserving its natural beauty and resources. By incorporating DWTUs into septic-to-sewer projects, communities can embrace a forward-thinking approach that balances environmental protection with economic practicality. Southern Water Distribution and Southern Water and Soil, Inc. stand ready to help municipalities and developers engineer a cleaner, greener future for Florida. Together, they are transforming wastewater challenges into sustainable solutions, ensuring the Sunshine State thrives for generations to come. **Greg Mayfield, RS, MSC, CEHP** **Southern Water and Soil, Inc.** **Southern Water Solutions, Inc.** ### Related Posts: [## A Decentralized Solution: Distributed Wastewater Treatment Systems](https://southernsepticanddesign.com/septic-services-blog/a-decentralized-solution-distributed-wastewater-treatment-systems/)[## Unlocking Economic Potential: The Case for Distributed Wastewater Treatment Systems in Florida](https://southernsepticanddesign.com/septic-services-blog/unlocking-economic-potential-the-case-for-distributed-wastewater-treatment-systems-in-florida/) **Categories:** Septic Services Blog **Tags:** Distributed Wastewater Treatment Systems --- ### [Everything You Need to Know About Our Septic System Inspections](https://southernsepticanddesign.com/septic-services-blog/everything-you-need-to-know-about-our-septic-system-inspections-infographic/) **Published:** February 28, 2024 **Author:** Southern Water Soil **Content:** At Southern Water and Soil, [we provide septic system inspections for homeowners and business owners](/septic-inspections-dade-city-fl/septic-system-inspections/). We’re experts in our field when it comes to inspecting, designing, and engineering septic systems of all sizes and types. ![Everything You Need to Know About Our Septic System Inspections](/wp-content/uploads/2024/02/238212-Southern-Water-and-Soil_Approved-res.jpg) **Reasons to Request an Inspection** There are many times when you might need to have a septic system inspected: - You’re buying or selling a residential property. - You’re buying or selling a commercial property. - You’re buying or selling vacant land that will be developed. - You’re moving, expanding, or replacing your septic system due to remodeling, property development, or zoning changes. - You’re building or installing a new/replacement system to meet updated health or environmental codes. **Types of Septic Inspections We Do** We conduct three main types of [septic system inspections](/septic-inspections-dade-city-fl/septic-system-inspections/): 1. **Residential Basic Inspections** If you need your septic system located, a basic, visual inspection is likely a good fit. These inspections include: - Estimating the size and volume of the tank - Estimating the size of the drain field - A septic system report card with the details of the inspection 2. **Residential Enhanced Inspections** If you need your system and drain field inspected with a camera, pumped, or need more detail about your system, this inspection is the right choice. These inspections include: - A septic system pump-out - A camera inspection on both the septic tank and drain field - A detailed measurement of tank size and volume - A detailed measurement of drain field size and overall functionality - A thorough written report of the overall state of the system and drain field 3. **Commercial Septic Inspections:** If you’re a septic or building contractor and require an initial or final inspection onsite, we can help. Here’s what our commercial inspections include: - Advisement on septic equipment - Equipment, repair, and/or installation recommendations based on the size, use, and type of property Note that we will need a number of documents and details about the project before the start of the inspection. **We Also Offer Septic Design & Engineering** Are you building, redeveloping, or rezoning for any reason, and the work requires septic system design and engineering? Make us your first call! We properly design and engineer septic systems and make sure all systems meet local installation codes. ### Related Posts: [## Buying a New Property for Your Business? Don’t Forget About Septic System Inspections](https://southernsepticanddesign.com/septic-services-blog/buying-a-new-property-for-your-business-dont-forget-about-septic-system-inspections/)[## Your Complete Guide to Septic System Inspections in Florida: What Contractors and Property Owners Ne...](https://southernsepticanddesign.com/septic-services-blog/your-complete-guide-to-septic-system-inspections-in-florida-what-contractors-and-property-owners-need-to-know/) **Categories:** Septic Services Blog **Tags:** septic system inspections --- ### [What is a Basin Management Action Plan (BMAP)?](https://southernsepticanddesign.com/septic-services-blog/what-is-a-basin-management-action-plan-bmap-infographic/) **Published:** November 3, 2023 **Author:** Southern Water Soil **Content:** A Basin Management Action Plan ([BMAP](/nitrogen-reducing-septic-system-florida/basin-management-action-plan/)) is a comprehensive and strategic document developed to address water quality issues and manage water resources within a specific river basin or watershed. The main goal of a BMAP is to protect and restore the water quality of a specific body of water. **![What is a Basin Management Action Plan (BMAP)?](/wp-content/uploads/2023/11/228276-Southern-Water-and-Soil_V2-1-res2.jpg)** **Florida’s New Law** As of July 1, 2023, any property in Florida with a BMAP must now use a nutrient-reducing septic system. Watershed properties that are one acre or less in these counties must install one of these systems: - Hillsborough - Pasco - Hernando - Citrus - Sumter **The Impact on Homes and Businesse** This new mandate is designed to significantly reduce pollutants in the watershed, and it may affect you in one of the following ways: - Your septic system could be vulnerable to failure or compromise - A failed septic system could impact current groundwater conditions - You may need to redesign or update your wastewater disposal system **Our Areas of Expertise** In light of this new law, we have you covered because we are experts in solutions that meet updated septic system standards. Some of these solutions include: - NSF-245 septic systems - Norweco septic systems - Fuji clean septic systems - Geoflow drip septic systems **Categories:** Septic Services Blog **Tags:** BMAP --- ### [Nutrient-Reducing Septic Systems Required in Florida](https://southernsepticanddesign.com/septic-services-blog/nutrient-reducing-septic-systems-required-in-florida/) **Published:** July 3, 2023 **Author:** Southern Water Soil **Content:** Effective July 1, 2023, properties located in impaired watersheds with a basin management action plan ([BMAP](/nitrogen-reducing-septic-system-florida/basin-management-action-plan-florida/)) and Reasonable Assurance Plan (RAP) need to address nutrients. Lots that are one acre or less in watershed areas of Hillsborough, Pasco, Hernando, Citrus, and Sumter Counties now require nutrient-reducing septic systems, also called [NSF 245 septic systems](/nitrogen-reducing-septic-system-dade-city-fl/nsf-245-septic-systems/) or [nitrogen-reducing septic systems](/nitrogen-reducing-septic-system-florida/). ![Nutrient-Reducing Septic Systems Required in Florida](/wp-content/uploads/2023/06/20230623_151602-res.jpg) At Southern Water and Soil, we can design and permit your project and help you make sound decisions based on experience. Greg Mayfield, President of Southern Water and Soil, has 27 years of experience in the septic industry. Kyle Harper, PE is Vice-President, and together, they lead a group of talented people ready to tackle your commercial or residential development. Through sound science and experience, we can guide you through the options for your project. There are many technologies that can be designed and permitted for your project. Let our team at Southern Water and Soil guide you through the process. **Categories:** Septic Services Blog --- ### [Why NSF 245 Septic Systems are Superior to INRB Systems for Enhanced Nutrient Reduction](https://southernsepticanddesign.com/septic-services-blog/why-nsf-245-septic-systems-are-superior-to-inrb-systems-for-enhanced-nutrient-reduction/) **Published:** June 27, 2023 **Author:** Southern Water Soil **Content:** Enhanced nutrient reduction systems are the buzz here in Florida. In order to protect our natural resources, we must all do our part to improve the water quality. Septic systems play an important role within our watersheds. Florida has many impaired water basins that require an action plan. These basin management action plans (BMAPs) require a reasonable assurance plan (RAP). These plans will require an enhanced nutrient reducing septic system. ![Why NSF 245 Septic Systems are Superior to INRB Systems for Enhanced Nutrient Reduction ](/wp-content/uploads/2023/06/2012-11-21-10.29.41-res.jpg) At Southern Water and Soil, we believe that [NSF 245 septic systems](/nitrogen-reducing-septic-system-dade-city-fl/) are the best alternative when compared to an INRB or in-ground nitrogen reducing system. We will discuss the difference. The INRB is a passive system using wood chips as a way of slowing down water. This creates a saturated environment beneath the drain field that helps treat nitrogen. However, the INRB system that is approved has not been tested to reduce nitrogen to 65 percent as touted by some. The INRB can also induce premature drain field failure due to the reduced flow vertically. The NSF 245 septic systems, like Norweco and Fuji, have been tested by the National Sanitation Foundation (NSF) and have been proven to reduce nitrogen by 67 percent or greater. At Southern Water and Soil, we have designed thousands of Norweco and Fuji systems in the state of Florida. They have a proven track record and increase the longevity of the drain field. If you need a septic design with enhanced nutrient reduction, then look no further than our team at Southern Water and Soil. We would be [happy to discuss NSF 245 septic systems](/nitrogen-reducing-septic-system-dade-city-fl/) or other options with you. **Categories:** Septic Services Blog **Tags:** NSF 245 Septic Systems --- ### [What to Know About Miami’s Septic to Sewer Commercial Corridors Program](https://southernsepticanddesign.com/septic-services-blog/what-to-know-about-miamis-septic-to-sewer-commercial-corridors-program/) **Published:** May 10, 2023 **Author:** Southern Water Soil **Content:** When access to a public sanitary sewer system is not available in an area, the property owner may choose to install a septic system for onsite wastewater disposal. Even when these systems are properly cared for, they naturally discharge nutrients into surrounding water resources. ![What to Know About Miami’s Septic to Sewer Commercial Corridors Program](/wp-content/uploads/2023/05/iStock-1076667892-res.jpg) To improve the water quality here in Miami and throughout Florida, a significant reduction in the level of pollutants in the watershed must occur. The excess nutrients coming from septic tanks and other sources can result in an algae-based ecosystem, which can affect the habitats of fish, birds, and other marine species. Through the[ Septic to Sewer Commercial Corridors program](/residential-septic-miami-fl/), Miami-Dade County is making an effort to extend sanitary sewer service to those with a septic system in order to protect the health of the area’s delicate water ecosystem. Under current groundwater conditions, thousands of existing septic systems are vulnerable to failure or compromise. Through the Septic to Sewer Commercial Corridors program, the county is prioritizing the conversion of septic systems to connections to the sewer system on parcels that have the largest likelihood of failure while also considering other social, economic, and environmental ranking criteria. The initial focus of this program is to connect properties that already have access to existing sewer infrastructure. From there, the work will shift to expanding the county’s sanitary sewer system and connect properties with septic systems based on their level of risk. The county also has many requirements in place to protect natural water resources when a new septic system is installed. For example, the OSTDS must be placed at least 75 feet away from any bay, lake, or surface water and 10 feet away from any storm water pipes. We are extremely familiar with these requirements at Southern Water and Soil, and we can make sure you comply during the installation of your new septic system. For more information about the [Septic to Sewer Commercial Corridors program or septic installation requirements](/residential-septic-miami-fl/), reach out to us today. **Categories:** Septic Services Blog **Tags:** Septic to Sewer Commercial Corridors Program --- ### [Diagnosing Septic Drainfield Problems](https://southernsepticanddesign.com/septic-services-blog/diagnosing-septic-drainfield-problems/) **Published:** November 24, 2013 **Author:** Southern Water Soil **Content:** We get asked all the time, “what makes my septic system drainfield fail?” What we are going to discus in this article is things that cause septic system drainfield problems and how you can avoid these problems. 1\. Excessive Water Use – monitoring your water use is one of the number one culprits of drainfied failure. When you use more water than what your septic tank and drainfield can handle you cause solids to move into the drainfield and creates a bio-mat build up underneath of the drainfield system. This causes the water to back up into the tank and into the house. This becomes a severe problem and usually results in a complete drainfield replacement. ![Excessive Water Use](/wp-content/uploads/2015/06/Excessive-Water-Use1.jpg) 2\. Excessive Use of Fats, Oils, and Greases (FOGS) – People don’t realize that when they cook the excess grease and oil that is left in and on the dishes get washed into the system and pass through the septic system if washed down the sink. You should scrape as much off into the garbage or other means of disposal. This build up of FOGS will lead to a premature drainfield failure. If you are installing a new septic system it is prudent to add an under sink grease interceptor or you can install a separate grease tank for the kitchen waste. This will allow the grease to accumulate in the tank and not in the drainfield. ![Clogged by FOGs1](/wp-content/uploads/2015/06/Clogged-by-FOGs1-e1434530308902.jpg) 3\. Excessive Water Drainage – I can’t emphasize this problem enough. When a homeowner installs a gutter system around their home please account for the location of your septic tank and drainfield are located. Many times the septic system is located near where the roof drains are located and this causes an extra burden on the drainfield system. Relocating gutter down spouts is an important factor in the longevity of the septic system. ![Roof Runoff Causes Damage1](/wp-content/uploads/2015/06/Roof-Runoff-Causes-Damage1.jpg) 4\. Seasonal High Water Table – Building the septic system below the seasonal high water table hampers the function of the septic system and is detrimental to the public health. Current septic rules in Florida don’t allow septic systems to be installed into the water table. If your septic system is in the water table this could be one of the problems with effluent draining out of the septic tank. ![High Water Table Situation1](/wp-content/uploads/2015/06/High-Water-Table-Situation1.jpg) 5\. Septic Drainfield Undersized – Many times homeowners undersize their septic system unknowingly. The drainfield product today allows for reductions in surface area. This reduction causes a false sense of security that the septic system is big enough for their needs. Many studies are based on septic system surface area square foot by square foot. However, when these reductions are taken the septic system doesn’t last as long. Make sure your septic system is sized properly for your use. When it is time to repair the septic system make sure you install what is required for your use when you upgrade the septic system. The septic system code has a bare minimum; however, many times a larger drainfield gives you more bang for your buck. ![Septic System Upgrade](/wp-content/uploads/2015/06/Septic-System-Upgrade1.jpg) 6\. Proper Sealing of Tank and Risers – In order to not have excessive rainwater and groundwater to enter the septic system it is important to seal the septic tank risers and lids. This will allow only wastewater to enter the system. Excess water intrusion can cause septic systems to back up. Also, if there is a lift station excess water will not be pumped to the drainfield. ![Septic Tank Riser](/wp-content/uploads/2015/06/Septic-Tank-Riser1.jpg) Southern Water and Soil, Inc., is your full service septic company providing septic service to the following areas: Tampa, Zephyrhills, Brandon, Lutz, Odessa, Wesley Chapel, Land O’ Lakes, Riverview, Ruskin, Plant City, Seffner, Thonotosassa, Dade City, Lakeland, and Wimauma. Call SWS with your septic system problems. **Categories:** Septic Services Blog --- ### [Septic Design and Engineering](https://southernsepticanddesign.com/septic-services-blog/septic-design-and-engineering/) **Published:** January 23, 2014 **Author:** Southern Water Soil **Content:** Southern Water and Soil septic engineers can help you through the entire septic design and installation process. Whether you are installing a new septic tank system, an aerobic treatment unit, need a septic system re-design or repair, or want to hook up to your city or county sewer system, our team of professionals are here to assist you. ### Related Posts: [## Septic Rejuvenation](https://southernsepticanddesign.com/septic-services-blog/septic-rejuvenation/)[## The Septic Experts](https://southernsepticanddesign.com/septic-services-blog/the-septic-experts/) **Categories:** Septic Services Blog **Tags:** Septic --- ### [Septic Rejuvenation](https://southernsepticanddesign.com/septic-services-blog/septic-rejuvenation/) **Published:** February 23, 2014 **Author:** Southern Water Soil **Content:** A septic system drainfield is used to remove water laden with contaminants and impurities from the septic tank. Over the years with continued use the drainfield develops a biomat. This biomat build up creates a problem with the percolation of the organic loaded water from the septic tank. There is an aerobic process that one can implement to rejuvenate the soil absorption system. There are several options when it comes to septic system rejuvenation. [Request Septic Rejuvenation Service](/contact-southern-water-and-soil/ "Contact US")** today. ## Chemical Custom Cleaning With a Chemical Custom Cleaning, SWS technicians will first “de-water” (pump) your leach field in order to remove excess saturation. At this time, we will install a drainfield access port to allow us easy access to the leach field or drain field for future services. Our certified technicians will also “activate” the bacteria and enzymes into the drainfield laterals. While the bacteria and enzymes are breaking new and preferred pathways into the drainfield bed or trenches, our technicians will use a high pressure water jetting machine to hose down each lateral line to wash out the heavy bio-mat that has built up in your field. Southern Water and Soil technicians will then take the bacteria and enzymes and pour it into the distribution box or header port where we will jet it down each lateral drain field line to ensure that the bacteria is spread throughout your entire field. Over the next few weeks, the bacteria will continue to grow and eat away at the heavy organics and bio-mat allowing your field to drain more easily. Finally, we will pour an additional gallon bacteria and enzymes to rejuvenate your septic tank before closing it up. As you continue to use your septic system, this bacteria will activate and eventually seep out into your leach field as well. Aerobic Activation System In certain cases, SWS may provide the best solution to a clogged drain field. An aerobic bio-reactor such as the Infiltrator Aquaworx Bioreactor would be installed in your septic tank to create an oxygen rich environment by cultivating a large colony of bacteria. With the system completely agitated and aerated, the bacteria will thrive in your tank, eating away at the organic materials that enter. During this time, the bacteria are carried out into the leach field where they will eat away at the heavy bio-mat that has built up under the drain field lines. As this system works, you will need regular pumping and maintenance along with regular inspections to ensure that it is functioning properly. Also, the installation of a commercial filter is imperative for the function of the system. If the desired results do not appear (after 12 months), there is a money back guarantee. Ask to speak with our Aerobic Activation adviser for more information to see if you system qualifies. ## Sewer Jetting If you are experiencing any issues with blockages, Southern Water and Soil’s high pressure water jetters can help to clean sewer lines, drain field lines, etc. Many SWS customers schedule yearly jetting maintenance to avoid a blockage. Soap, grease build up, hair and other household debris contribute to the development of sludge in the main line and this could result in a blockage. ### Related Posts: [## The Septic Experts](https://southernsepticanddesign.com/septic-services-blog/the-septic-experts/)[## Septic Design and Engineering](https://southernsepticanddesign.com/septic-services-blog/septic-design-and-engineering/) **Categories:** Septic Services Blog **Tags:** Septic --- ### [Why Choose an Infiltrator Drain field?](https://southernsepticanddesign.com/septic-services-blog/why-choose-an-infiltrator-drain-field/) **Published:** March 23, 2014 **Author:** Southern Water Soil **Content:** ![Infiltrator EQ36 Low Profile](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Infiltrator-EQ36-Low-Profile1.jpg) Drain fields, also known as leach fields or leach drains, play a very crucial role within the septic system. These subsurface structures clean wastewater before it returns to the water cycle. Essentially, drain fields act as natural water recycling centers. Before traveling to the drain field, wastewater enters the septic tank where it’s separated into sludge (heavy, sinking solids) and scum (floating solids such as oil and grease). Liquid waste, commonly known as effluent or grey water, can be found in between the sludge and scum layers. As new raw sewage enters the tank, the old wastewater is displaced and pushed toward the drain field. ![Septic Tank and Drainfield Installation](/wp-content/uploads/2015/06/Septic-Tank-and-Drainfield-Installation.jpg) When installing a new septic system, the experts at Southern Water and Soil, Inc. will design a drain field that best fits the features of your property according to municipal and state codes. They will examine the size of your lawn, soil type, water table depth, and other topographical features to ensure quality wastewater filtration. In many cases, SWS will choose to install a plastic chamber drain field produced by Infiltrator Systems. SWS serves the entire Greater Tampa Bay area including, but not limited to, Zephyrhills, Lutz, Plant City, Brandon, Land O’ Lakes, Dade City, and Odessa. About Infiltrator Systems’ Plastic Drain Field Chambers Developed over 25 years ago, the Infiltrator plastic drain field chamber was the first of its kind with now more than 1 million systems installed in all 50 states and 13 countries. Unlike the PVC pipe and stone traditional drain fields are constructed of, the Infiltrator System consists of several 4-foot high, half-tube chambers that are locked end-to-end and capped with a dome-shaped end plate. Effluent from the septic tank flows freely into these chambers and filters through the soil absorption area below. ![Septic Repair Installation](/wp-content/uploads/2015/06/Septic-Repair-Installation.jpg) Installation of an Infiltrator System plastic chamber drain field is a breeze, especially when Southern Water Soil President Greg Mayfield and his experienced team are on the job. Because the individual chambers are so lightweight and the addition of crushed rock to the drain field is not an issue, installation can take less than half the time when compared to a conventional drain field. And because no stone is needed which requires the use of heavy equipment like dump trucks, you’ll save money as well as time. Comparing Traditional Drain Fields with the Infiltrator System ![Drain field Replacement](/wp-content/uploads/2015/06/Drain-field-Replacement.jpg) The benefits of installing an Infiltrator System plastic chamber drain field are endless. Let’s compare the two systems. Infiltrator Systems require easy assembly which can be accomplished by two people while the traditional stone and pipe system is extremely labor-intensive due to its lengthy installation of multiple parts. Infiltrator Systems’ plastic chambers are lightweight and can be delivered in one pickup truck load. These chambers can be hand-carried into position. The traditional system requires hauling of stone, which calls for the use of a dump truck and other heavy equipment. The use of heavy equipment and traffic across your property also means more site repair after installation to re-grade and repair the landscape. ![New Septic Tank System](/wp-content/uploads/2015/06/New-Septic-Tank-System.jpg) The open-bottomed plastic chambers of the Infiltrator System allow for unobstructed infiltration of effluent into the soil, while solids can build up between the stones surrounding a traditional drain field PVC pipe, limiting infiltration. Soil compaction of a traditional system can also reduce infiltration rates, but the Infiltrator Systems’ large chambers accommodate large volumes of effluent to flow freely. ![Infiltrator Chamber System](/wp-content/uploads/2015/06/2014-03-20-12.29.38-resized.jpg) Overall, with an Infiltrator System plastic chamber drain field, you’ll save time and money. Contact Southern Water and Soil today to see if Infiltrator Systems’ products are right for your septic system. **Categories:** Septic Services Blog --- ### [Septic Tank Pumping Tampa, FL](https://southernsepticanddesign.com/septic-services-blog/septic-tank-pumping-tampa-fl/) **Published:** March 23, 2014 **Author:** Southern Water Soil **Content:** If gurgling in the toilet or back up in the bathtub has you asking about septic tank pumping cost then it is time to start doing some research. SWS will give you the information you need to keep from paying an arm and a leg for your septic system problem. Proper septic tank maintenance means that you will have your septic system serviced every two to three years to keep the system from getting build-up. The cost of pumping or cleaning the septic tank will depend on the amount of solids build-up and the size of your tank. ![Septic Tank with Filter](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Septic-Tank-with-Filter.jpg) Regular septic tank maintenance is necessary to eliminate future septic problems and cost for you. You can use a bacteria/enzyme product that is approved by the Florida Department of Health to create a healthy environment for you septic system and drainfield. SWS can install a header pipe or distribution box system that allows the introduction of the bacteria and enzymes directly to the root of the problem. You can purchase a maintenance and warranty package from SWS so that costly septic repairs and replacement costs are waylaid. Some products for the septic system should be avoided. Call SWS and we can discuss safe and useful products for your septic system. There are many options when it comes to septic system repair, drainfield cleaning, or drain cleaning or repairing. Depending on your situation and septic problem you could be looking at a major expense in both the septic tank plumbing cost and the cost of redoing your lawn. SWS offers trenchless repairs such as (line jetting, bacterial bio-reactors, and bacteria and enzymes, root inhibitor, etc.). Due to the age of the system or the condition of the drainfield or the nature of the failure it might be the best alternative to completely replace the drainfield. SWS offers advice and consultation for homeowners that want to do the work themselves. DIY septic is probably not something you want to tackle yourself. However, if you do want to tackle doing your septic repairs yourself SWS is here to help. This is a job better left in the hands of a professional. SWS offers free quotes for septic system replacements and we can do the job for you. Try to get several quotes up front rather than relying on the first contractor you speak to. Septic tank cleaning and repair services will vary in price with the amount of work to be done. Check with the Better Business Bureau to find a reputable, dependable service to ensure you get the best work and the best septic tank service. **Categories:** Septic Services Blog **Tags:** Septic Tank Pumping --- ### [Common Septic System Issues](https://southernsepticanddesign.com/septic-services-blog/common-septic-system-issues/) **Published:** April 15, 2014 **Author:** Southern Water Soil **Content:** Through Southern Water and Soil, your residential or commercial septic system—ensured to be designed and constructed according to code by experts with over 100+ years of combined experience—should function relatively trouble-free. A septic system is designed specifically to treat human biological waste for safe return to the environment. After wastewater exits your home, it is held in a large tank where solids and liquids are separated. While the solids either rise to the top of the tank (scum) or sink to the bottom (sludge), the liquids are extracted from the tank and travel into the drain field where it is discharged into the soil and treated naturally through filtration. It is suggested that solid waste be removed from the tank every two to five years (depending on water usage) by a certified wastewater professional. ![Common Septic System Issues](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Common-Septic-System-Issues1-300x179.jpg) Although a septic system is meant to handle human waste, other materials tend to make their way into the tank which can cause substantial damage to the entire system. Solid, non-biodegradable waste such as feminine products, diapers, paper towels, grease, hair, and cigarette butts can clog your septic tank while toxic chemicals like paint thinners, solvents, pesticides, gasoline, and other fluids kill off the helpful bacteria essential to breaking down solid waste. It’s also imperative to remember that all water used in the home is eventually stored in the septic system. From your dishwasher and toilet, to your washing machine and shower, excessive water use can cause system failure. Conserve your water use, especially during rainy season to reduce your risk of drain field backup. **What to Do When It’s Too Late** Improper usage of your household plumbing fixtures can lead to severe problems with your septic system. Here are a few signs your septic system is not working properly: – Odors, surfacing sewage, or lush vegetation growth in the drain field area – Plumbing or septic tank backups – Slow draining fixtures – Gurgling sounds in the plumbing system – Well and tests that show the presence of coliform (bacteria) or nitrates Whether your home or business is based in Lutz, Plant City, Zephyrhills, Brandon, Land O’ Lakes, Dade City, Odessa, Wesley Chapel, and beyond, Southern Water and Soil is ready to repair any septic system issue. During each repair, they will inspect the septic tank cover, septic tank, distribution box, inlet/outlet t’s, baffles, drain field lines, and other system components to halt septic system problems that could occur in the future. Their goal is to increase the longevity of your system and bring you peace of mind. When your septic system is failing, they’ll be sure to create a comprehensive and cost-effective solution through the use of innovative products. ![Watertight Riser Package](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Common-Septic-System-Issues2-300x168.jpg) Water is one of our world’s most important and vulnerable natural resources. Therefore, knowing how your septic system works is important and will save not only save you trouble in the long run but hundreds of dollars as well. The technicians at Southern Water and Soil will be sure to educate you on the ins and outs of your system during installation and repair. In addition, feel free to contact them at any time with questions or concerns. ### Related Posts: [## Commercial Septic System Contractor](https://southernsepticanddesign.com/septic-services-blog/commercial-septic-system-contractor/)[## Mobile Home Park Septic System Design, Engineer, and Install](https://southernsepticanddesign.com/septic-services-blog/mobile-home-park-septic/) **Categories:** Septic Services Blog **Tags:** Septic System --- ### [Package Wastewater Treatment Plants](https://southernsepticanddesign.com/septic-services-blog/package-wastewater-treatment-plants/) **Published:** May 5, 2014 **Author:** Southern Water Soil **Content:** If your business or residence is not connected to a municipal sewer system, it’s most likely your property relies on a septic system to treat wastewater. When you’re in need of septic system installation, maintenance, or repair and you’re located in the Greater Tampa Bay area, Southern Water and Soil will be at your service. When a traditional septic system consisting of a septic tank and drain field is not ideal for your property, Southern Water and Soil will engineer a wastewater treatment solution best for you, and many times a package treatment plant will be the best option. **How Do Package Treatment Plants Work?** A package treatment plant consists of a multi-chamber tank. Unlike conventional septic systems, all package treatment plants use an aerobic digestive process to treat raw sewage. Through the use of oxygen-using bacteria, solid matter is reduced at a more rapid rate. Treatment of wastewater in a package system is accomplished in three stages. First, sewage enters the pretreatment chamber similar to that of a traditional septic tank. Here, heavy solids (sludge) sink to the bottom of the chamber, separating themselves from the wastewater and floating solids like oils and grease (scum). During the second stage of treatment, oxygen is mixed with the scum and liquid mixture. In this phase, aerobic bacteria reduce the sewage into simple compounds. An air pump or compressor provides aeration. Depending on the package treatment plant selected, aeration can take place in the first chamber, which also helps break down sludge or it takes place in its own chamber apart from the sludge. If the latter design is chosen, the pretreatment chamber which stores the sludge must be periodically pumped. The final stage takes place in the clarification chamber. Here, heavier solids are separated from the effluent and returned to the aeration chamber for further processing. The clarified liquid then enters the environment for proper disposal. **Norweco Products** Southern Water and Soil has partnered with the innovative company Norweco—a leading manufacturer of wastewater treatment products, systems, and chemicals sold throughout the world. Norweco specializes in small-flow treatment applications ranging from municipal treatment systems for small towns to systems for the individual family home. Their motto: “Today’s Answer for the Protection of Tomorrow’s Environment.” Through its alliance with Norweco, Southern Water and Soil is trained to install and maintain the company’s wastewater treatment products, including the Singulair Residential Wastewater Treatment System (designed for domestic wastewater flows ranging from 500 to 1,500 gallons per day), the Modulair Package Wastewater Treatment System (1,500 to 500,000 gallons per day), the Travalair Package Wastewater Treatment System (up to 500,000 gallons per day), and more. All systems are constructed of a precast concrete tank. Southern Water and Soil serves Tampa Bay, Lutz, Plant City, Brandon, Riverview, Valrico, Bartow, Lakeland, Zephyrhills, Dade City and surrounding Tampa Bay area communities with septic and wastewater system services. Southern Water and Soil provides its clients with complete services from engineering and permitting to installation and maintenance. Call them today for all your septic needs! **Categories:** Septic Services Blog --- ### [Septic System Installation in Brandon, Florida](https://southernsepticanddesign.com/septic-services-blog/septic-system-installation-brandon-fl/) **Published:** June 2, 2014 **Author:** Southern Water Soil **Content:** Last week SWS installed a septic system for a Brandon, Florida homeowner. The septic system he had installed approximately 8 years ago began to fail. The system appeared to have been crushed when installed. Also, it appeared that the tank had been compromised due to holes being knocked into the side of the tank. So, we installed a new 1090 gallon Infiltrator System tank, a 9″ Bear Onsite filter, and 633 square feet of Infiltrator Quick 4 LP Chambers. The installation went as planned and there were no problems encountered. The soil was a Gainesville loamy fine sand, so we installed a larger drainfield to accomodate for the loamy soil and the use of the homeowners. ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/2014-05-28-16.45.17-resized-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/2013-11-26-10.14.28-e1401726420553-resized-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/2014-05-28-07.45.18-resized-150x150.jpg) If you are in need of a new septic system or just need someone to diagnose what is happening to your septic system then don’t hesitate to call us and we will get your septic problems under control. We strive to make all of our customers happy and we want to make sure that the system is working properly. If not, we can get you a quote to get the system repaired and running right. SWS provides [septic services](https://www.sw-soil.com/residential-septic/septic-repair-service/ "Septic Repair Service") in Hillsborough, Pasco, and Polk Counties for residential systems and provides [commercial septic services ](https://www.sw-soil.com/engineered-septic/commercial-septic-system-contractor/ "Commercial Septic System Contractor")to the entire State of Florida. SWS residential service area includes but is not limited to Dade City, Zephyrhills, Wesley Chapel, Lutz, Land O’ Lakes, Odessa, Ridge Manor, Webster, Thonostosassa, Plant City, Brandon, Riverview, Gibsonton, Lakeland and Tampa. **Categories:** Septic Services Blog --- ### [Septic Repair Service](https://southernsepticanddesign.com/septic-services-blog/septic-repair-service/) **Published:** June 23, 2014 **Author:** Southern Water Soil **Content:** Our septic system repair team can handle just about any septic repair needed for your system. We can install new septic tank covers and build up riser collars for your septic tank lid or cover. We can repair and replace drain lines and distribution boxes. At Southern Water and Soil, we service your septic system and inspect each component to make sure the system is in good working condition and will stay that way for many years to come. [**Request Septic Repair Service**](/contact-southern-water-and-soil/ "Contact US") today. ## Cover Replacement Safety is a high priority at Southern Water and Soil and we want to make sure that your septic tank cover is not a potential hazard. We will inspect your septic tank cover for any weakness and will recommend a replacement if we identify a septic tank lid or cover problem. Southern Water and Soil has several different cover sizes in stock and can handle a replacement of any size and shape. ## Distribution Box, Inlet/Outlet T’s And Baffles Southern Water and Soil can repair or replace your faulty D-Box or also called Distribution Box, Inlet/Outlet T’s, effluent filters, and septic tank baffles or lids. ## Line Repair Or Replacement Southern Water and Soil can repair or replace any break or crack to the main septic line that distributes effluent to your septic drain field. ## Build Up or Riser Extension Some septic systems have covers that are entrenched deep underground. To prevent any problems during servicing, Southern Water and Soil can install a riser or build up, to raise the level of your access point to the ground surface. This will help you to save money on digging fees and prevent septic servicing problems during times of septic problems. ## Septic Tank Repair If you are having a problem with low levels in your septic tank system, Southern Water and Soil technicians can inspect your septic tank for cracks, leaks, or holes. We will also attempt to seal your septic tank in an effort to save the septic system. Excess sand can infiltrate your drainfield and cause a septic drainfield failure. **Categories:** Septic Services Blog **Tags:** Septic Repair --- ### [Southern Water and Soil: Greater Tampa Bay’s One-Stop Septic System Shop](https://southernsepticanddesign.com/septic-services-blog/tampa-bay-septic-systems/) **Published:** March 25, 2014 **Author:** Southern Water Soil **Content:** ![Greg and Tanya Mayfield](/wp-content/uploads/2015/06/weavermayfield-39.jpg)When it comes to installing, repairing, and maintaining a septic system on your residential or commercial property, you’ll want to utilize the services of a trusted company with plenty of experience. If you live in Lutz, Plant City, Zephyrhills, Brandon, Land O’ Lakes, Dade City, Odessa, or another community in the Greater Tampa Bay area and are in need of a wastewater treatment solution, look no further than Southern Water and Soil, Inc. With over 100+ years in the wastewater treatment industry, Southern Water and Soil’s mission is to “provide a highly cross-trained team who exceed customers’ expectations and offer septic services that are designed properly, cost effective, and installed with minimal headaches.” Southern Water and Soil is lead by President Greg Mayfield. Prior to starting SWS, Greg worked with the Florida Department of Health and the Southwest Florida Water Management District. SWS Vice President Robert “Bob” Dasta is also extremely familiar with wastewater treatment systems, having previously worked with the Florida Department of Environmental Protection and the Southwest Florida Water Management District. It’s apparent these two experienced leaders know the ins and outs of the wastewater treatment industry, fully understanding wastewater system regulations and health department standards. **Septic Engineering** Southern Water and Soil offers customers a variety of options when it comes to septic tank installation and repair. From Orenco Advantex Treatment systems and Geoflow Drip Irrigation, to Infiltrator systems and Norweco Singular Green, SWS provides only the most innovative and reliable septic system products on the market. ![Commercial septic system installed in Florida-1](/wp-content/uploads/2015/06/Commercial-septic-system-installed-in-Florida-1.jpg) During the installation and design process, SWS will consider the number of people to use the system, examine the size of your lawn, measure the water table depth, and inspect the soil type to ensure you will receive the best wastewater treatment results possible. SWS installs 200 to 100,000 gallon wastewater systems which allows them to work for residential and commercial clients such as Lutz Medical Center, a Brooksville Taco Bell, and a Temple Terrace church, among others. They even designed and installed a septic system for an entire mobile home park in Tampa. ![Infiltrator Chamber System](/wp-content/uploads/2015/06/2014-03-20-12.29.38-resized.jpg) **Septic Repair** Southern Water and Soil can handle just about any septic repair needed for your residential or commercial system. From septic tank cover replacement and replacing faulty distribution boxes, to sealing septic tank cracks and repairing drain field lines, Southern Water and Soil covers it all when it comes to septic system repair. ![Infiltrator EQ36 Low Profile](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Infiltrator-EQ36-Low-Profile1.jpg) **Septic Maintenance** After installing or repairing a septic system, Southern Water and Soil takes the time to educate customers on how to maintain their system. Southern Water and Soil also offers customers septic rejuvenation services to help them maintain a system’s longevity. During each septic tank pumping, for example, Southern Water and Soil will inspect the entire system to make sure it’s functioning properly—they don’t just “pump and run!” They’ll also clean the filter and introduce a bacteria and enzyme additive to the tank to help break down solid waste. ![Septic and ATU Tank Installation](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Septic-and-ATU-Tank-Installation.jpg) Whether you’re in need of septic installation, repair, or maintenance, Southern Water and Soil is ready to serve you. Call them today! **Categories:** Septic Services Blog --- ### [Installing Commercial Septic Systems](https://southernsepticanddesign.com/septic-services-blog/installing-commercial-septic-systems/) **Published:** April 15, 2014 **Author:** Southern Water Soil **Content:** Commercial septic systems can be very large and complicated, but with Southern Water and Soil’s 100+ years of combined experience, they’ll make the installation of a new septic system as quick and cost-effective as possible. ![Commercial septic system installed in Florida. SWS is the commercial septic system experts.](https://southernsepticanddesign.com/wp-content/uploads/2015/06/2013-03-13-16.33.531-resized-300x169.jpg) Although Southern Water and Soil has installed a countless number of residential septic systems, they are also highly sought after in the Greater Tampa Bay area for commercial septic system installation, repair, and maintenance. Serving as the backbone of our nation, the septic system is the last thing small business owners should have to worry about. From Lutz, Plant City and Zephyrhills, to Brandon, Dade City, and Odessa—and even in North Carolina—the trusted Southern Water and Soil team led by Greg Mayfield will provide your company with an innovative wastewater treatment solution that lasts. Check out some of their previous commercial installation projects: ![Package Treatment for MHP](https://southernsepticanddesign.com/wp-content/uploads/2015/06/20130824_134223-resized-300x168.jpg) **Mobile Home Park** Southern Water and Soil installed a septic system for a 96 unit mobile home park in North Carolina. They utilized an Advantex AX-Max system, a great solution for small communities as it requires little electricity to operate and low maintenance. ![Low Pressure Pipe System](https://southernsepticanddesign.com/wp-content/uploads/2015/06/2011-03-18-19.25.18-300x225.jpg) **Church Septic System and Drain field** Southern Water and Soil installed a septic system for a church in Temple Terrace that featured an Infiltrator Systems plastic chamber drain field. The drain field was a very cost-effective solution for the church since the plastic product is lightweight, can be delivered in just one truckload, requires a small team of installers, and does not call for the use of a dump truck or other heavy equipment. ![Infiltrator Chamber System](https://southernsepticanddesign.com/wp-content/uploads/2015/06/2014-03-20-12.29.38-resized-300x168.jpg) **Hair Salon System Solutions** Southern Water and Soil installed an AdvanTex treatment system for Pasco County Hair Salon. This solution was chosen because of the limited space Southern Water and Soil had to work with. In addition, the previous system was beyond repair and failed several times before so it was imperative SWS install only the most advanced and trusted septic system products. ![Advanced Treatment System](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00642-300x225.jpg) **Commercial Retail Center in Tampa** The owner of a property could not fit the building, parking lot, and septic system on their lot. Southern Water and Soil came to the rescue and implemented the design of a PTI Multi Pipe drainfield system to make the lot buildable. The design reduced the footprint of the wastewater system by 33 percent when compared to a conventional septic tank and drain field system. ![Commercial Septic System](https://southernsepticanddesign.com/wp-content/uploads/2015/06/2011-03-18-18.49.25-300x225.jpg) **Carpet and Tile Retail Center** Southern Water and Soil installed an AdvanTex treatment system at a retail center in Ruskin. The design implemented reduced the footprint of the wastewater system by 65 percent when compared to a traditional septic system. In addition, the system installed provided supplemental irrigation to their landscaping. ![Engineered Designed Septic](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Septic-Retail-Center-300x224.jpg) It’s apparent Southern Water and Soil can create a customized wastewater treatment plan that will fit your business’ needs and its budget. A conventional septic tank with attached drain field doesn’t have to be the only answer to your wastewater treatment problems. SWS is certified to install some of the most advanced septic systems and products on the market today. Whether you have limited space or high water usage, SWS technicians will draft a high quality plan using top-of-the-line products. ### Related Posts: [## How Commercial Septic Systems are Different than Residential Ones](https://southernsepticanddesign.com/septic-services-blog/how-commercial-septic-systems-are-different-than-residential-ones/) **Categories:** Septic Services Blog **Tags:** Commercial Septic Systems --- ### [Our New Website is Live!](https://southernsepticanddesign.com/septic-services-blog/our-new-website-is-live/) **Published:** August 25, 2014 **Author:** Southern Water Soil **Content:** ![southern water and soils website](https://southernsepticanddesign.com/wp-content/uploads/2014/08/southern-water-and-soils-300x290.jpg)We’ve been working on a new site for the last month, and we’re pleased to say it’s finally live! What do you think of it? Got any comments or feedback? Please let us know by posting a message below. **Categories:** Septic Services Blog --- ### [Septic Systems – Can They Be Green?](https://southernsepticanddesign.com/septic-services-blog/septic-systems-can-they-be-green/) **Published:** September 26, 2014 **Author:** Southern Water Soil **Content:** ![Septic System Design](/wp-content/uploads/2014/07/2011-08-01-15.57.40-300x179.jpg)Yes, they can. Septic systems comprise of two basic components – the tank and the disposal area. Each one has a specific function in the treatment of residential wastewater that comes from bathing, kitchen wastes, laundry, and body wastes. This fairly simple method of treating wastewater can efficiently remove chemical nutrients and disease-causing pathogens from wastewater for the life of homes if septic systems are properly designed, installed, operated and maintained. Retention time in the tank is short, during which sludge, scum and liquid effluent is broken down. Solid matter will settle on the bottom (sludge), while buoyant matter, fats, grease, hair, etc. (scum), float to the top. In between these 2 layers is liquid effluent which goes to the drain field (disposal area). Solids in the tank are digested, and then converted to gases by bacterial microorganisms. It is these bacteria that need to be in a green environment in order to function and do their job effectively. This is where you, the homeowner, can play a big part in helping them stay happy and healthy, by ensuring the following: - Don’t pour any chemical toxins down the drains (they can kill the good bacteria). - Don’t pour anything that is not biodegradable down the drains or flushed down toilets. - Use a garbage disposal very sparingly (preferably, not at all). - Keep water-softener backwash out of septic systems. At Southern Water and Soil, we have more than 30 years’ combined experience in designing, engineering, installation, permitting and [maintenance of septic systems](/septic-systems/ "Septic Systems, Tampa FL"). We provide the Tampa area with wastewater and septic services, and the whole of Florida with septic engineering services. **Categories:** Septic Services Blog **Tags:** septic systems --- ### [Size is a Crucial Element of Septic System Design](https://southernsepticanddesign.com/septic-services-blog/size-is-a-crucial-element-of-septic-system-design/) **Published:** October 3, 2014 **Author:** Southern Water Soil **Content:** ![septic system design](/wp-content/uploads/2014/07/2013-02-15-17.14.27-300x168.jpg)Whether you are remodeling your existing home, or building a new one, having the right size septic tank is essential. Choosing a tank that’s too small for your needs can result in many expensive problems over time. To determine the size for your septic system design, start by looking at the average amount of water used in your home. This should include everything from watering the lawn to cooking and bathing. A good rule of thumb is to choose a septic system design that can hold twice your daily average water consumption. Anything smaller probably won’t work for long. Also consider the size of your home. A larger one is likely to house more people. So obviously, a 3-bedroom home will need a bigger tank than a home with one bedroom. However, it’s advisable to include one extra room to that equation to allow for situations when friends or relatives stay over for extended periods. Another [important factor in septic system design](/septic-systems/septic-system-design/ "Septic System Design, Tampa FL") is the amount of space you have available for installation of the tank. If there’s enough space to accommodate both the tank and the drain field, you can probably go with any size that you want. However, your municipality may require that the tank have a specific capacity in relation to the size of your property. At Southern Water and Soil, we have more than 30 years’ combined experience in designing, engineering, installation, permitting and maintenance of septic systems. We provide the Tampa area with wastewater and septic services, and the whole of Florida with septic engineering services. ### Related Posts: [## Septic System Design and Your Property](https://southernsepticanddesign.com/septic-services-blog/septic-system-design-and-your-property/)[## Engineered Septic System Design in Florida](https://southernsepticanddesign.com/septic-services-blog/engineered-septic-system-design-in-florida/)[## Why Septic System Design is Important to Get Right](https://southernsepticanddesign.com/septic-services-blog/why-septic-system-design-is-important-to-get-right/) **Categories:** Septic Services Blog **Tags:** septic system design --- ### [There’s No Definitive Answer about the Frequency of Septic Pumping](https://southernsepticanddesign.com/septic-services-blog/theres-no-definitive-answer-about-the-frequency-of-septic-pumping/) **Published:** November 14, 2014 **Author:** Southern Water Soil **Content:** ![septic pumping](/wp-content/uploads/2014/09/2011-02-23-14.24.15-300x179.jpg)While most professionals [recommend septic pumping every 3 years](/septic-services/residential-septic-services/septic-pumping/ "Septic Pumping, Tampa FL"), there really is no definitive answer to the frequency thereof. Some systems should, in fact, be pumped every year. The reason why no exact time frame can be given is quite simple. It all depends on how large the tank is and how many people are living in the home, and how much waste is discharged every day. Most counties, cities and towns that regulate the installation of septic tanks require a professional to plan or design a system before it can be installed. The designer must take into account the home’s size, the total number of occupants, and the total number of bedrooms. With this data, the actual tank can be sized. The problem is you might have bought a home not knowing if the existing tank is properly sized for the number of occupants. In this case, you should get an experienced professional out to your property. Often the size of the tank can be determined after septic pumping has been done. Once this is established, you will be told how often cleaning should be scheduled in the future. Remember, **septic pumping** is the only way to avoid thousands of dollars’ worth of damage to the drain field! At Southern Water and Soil, we have more than 30 years’ combined experience in designing, engineering, installation, permitting and maintenance of septic systems. We provide the Tampa area with wastewater and septic services, and the whole of Florida with septic engineering services. ### Related Posts: [## Septic Pumping: More than Meets the Eye](https://southernsepticanddesign.com/septic-services-blog/septic-pumping-more-than-meets-the-eye/) **Categories:** Septic Services Blog **Tags:** septic pumping --- ### [Septic Services Don’t Deserve the Bum Rap They Often Get!](https://southernsepticanddesign.com/septic-services-blog/septic-services-dont-deserve-the-bum-rap-they-often-get/) **Published:** November 28, 2014 **Author:** Southern Water Soil **Content:** ![septic services](/wp-content/uploads/2014/07/2012-11-21-10.30.10-300x168.jpg)You could say that **septic services** suffer with an inferiority complex! Some people mock them, saying they’re one step removed from outhouses. But nothing could be further from the truth. A septic system that’s properly designed, installed and maintained will treat wastewater just as efficiently as any municipal system. Actually, it might even do it better. Septic services also get a bad rap in the press with claims of groundwater pollution. Sure, it can happen, but many instances can be traced to poor maintenance by homeowners or inadequate initial design. A septic tank and its drain field can do their job, but the homeowner needs to be part of the team! Septic services are cost-effective. While there are sizeable upfront costs for the installation of a complete system, once it’s installed, periodic pumping and inspections should be the only expenses. Moreover, septic tanks take advantage of natural cleansing agents in soil. The microbes in soil act as very capable biological eating machines. Nonetheless, if soil has low permeability or it is waterlogged, wastewater may migrate to some other location before it gets converted to an environmentally-friendly state. That’s why it’s important to have your soil evaluated to see how well it drains. This task can be performed by a septic professional or an official from your local Board of Health. At Southern Water and Soil, we have more than 30 years’ combined experience in designing, engineering, installation, permitting and maintenance of septic systems. We provide the Tampa area with [wastewater and septic services](/septic-services/ "Septic Services, Tampa FL"), and the whole of Florida with septic engineering services. **Categories:** Septic Services Blog **Tags:** septic services --- ### [Knowing When NOT to Pump the Tank Can Avoid Septic System Repair](https://southernsepticanddesign.com/septic-services-blog/knowing-when-not-to-pump-the-tank-can-avoid-septic-system-repair/) **Published:** December 26, 2014 **Author:** Southern Water Soil **Content:** ![septic system repair](/wp-content/uploads/2014/07/2011-11-02-14.58.46-e1408945457110-300x179.jpg)Sometimes, it’s a bad idea to have a septic tank pumped out. Under certain conditions, it may be unsafe and lead to damage of the tank, resulting in the [need for septic system repair](/septic-services/residential-septic-services/septic-system-repair/ "Septic System Repair, Tampa FL"). The one issue that will be discussed here is after flooding. Pumping could cause a dangerous, or even fatal, collapse. If your home has been flooded by water from a hurricane, a river overflow or a storm, pumping the tank while the groundwater is still flooding the area can lead to sudden problems.If the tank is fiberglass or plastic, and if the groundwater is still high near it, the tank could actually float right up out of the ground, causing damaged piping and expensive **septic system repair**. It is important to wait until the groundwater and floodwater have receded around the tank. What about a concrete tank? Even then, if groundwater covers it, or the inlet and/or drain field piping is covered, the tank should not be pumped. If it is, floodwaters that carry mud and silt can flow into it, filling the tank with debris that will need to be professionally removed. Again, wait until the floodwater has receded, and the groundwater is low enough to prevent silt and mud from running back into the tank. At Southern Water and Soil, we have more than 30 years’ combined experience in designing, engineering, installation, permitting and maintenance of septic systems. We provide the Tampa area with wastewater and septic services, and the whole of Florida with septic engineering services. **Categories:** Septic Services Blog **Tags:** septic system repair --- ### [Commercial Septic System Contractor](https://southernsepticanddesign.com/septic-services-blog/commercial-septic-system-contractor/) **Published:** January 18, 2015 **Author:** Southern Water Soil **Content:** Southern Water and Soil, Inc., is one of Florida’s premier septic system contractors. SWS’s staff has years of experience in septic system engineering, design, and installation. SWS is vertically integrated company that provides a design-build option to their client. SWS can provide septic solutions to your septic system problem or project. If you are looking for a commercial septic system contractor then look no further than Southern Water and Soil, Inc. Here are a few projects that we have completed: **1.** **Commercial Onsite Wastewater System** – This system was installed for a 96 unit mobile home park located in North Carolina. SWS works on commercial systems in Florida and North Carolina. This system is an Advantex AX-Max Treatment System. This system treats the water to advanced wastewater treatment standards and reuses the water through the drip irrigation system that was installed. ![Commercial Wastewater System-s](/wp-content/uploads/2015/06/Commercial-Wastewater-System-s.jpg) **2. Septic System Installation for Fast Food Restaurant** – This septic system is a low pressure pipe dosing system. This was designed for Taco Bell in Brooksville, Florida. SWS engineered the septic system and installed the septic with several tanks and a multi-pipe drainfield system by PTI. ![Commercial LPPS Septic System-s](/wp-content/uploads/2015/06/Commercial-LPPS-Septic-System-s.jpg) **3. Church Septic System and Drainfield –** SWS installed this septic system for a church in Temple Terrace, Florida near Tampa, Florida. SWS installed an Infiltrator System. The septic tanks and drainfield product were manufactured by Infiltrator Systems. ![Septic Tank and Drainfield Installation-s](/wp-content/uploads/2015/06/Septic-Tank-and-Drainfield-Installation-s.jpg) ### Related Posts: [## Common Septic System Issues](https://southernsepticanddesign.com/septic-services-blog/common-septic-system-issues/)[## Mobile Home Park Septic System Design, Engineer, and Install](https://southernsepticanddesign.com/septic-services-blog/mobile-home-park-septic/) **Categories:** Septic Services Blog **Tags:** Septic System --- ### [Norweco Singular Green Wastewater Treatment System](https://southernsepticanddesign.com/septic-services-blog/norweco-treatment-system/) **Published:** January 26, 2015 **Author:** Southern Water Soil **Content:** Because its staff boasts a combined 100+ years of experience wastewater treatment systems engineering, installation, and maintenance, Southern Water and Soil is able to offer its customers in the Greater Tampa Bay area—including Zephyrhills, Wesley Chapel, Odessa, Land O Lakes, Dade City, and beyond—a variety of services and products. ![Norweco Singulair Green-s](/wp-content/uploads/2015/06/Norweco-Singulair-Green-s.jpg) Apart from traditional gravity-based septic tank and drainfield systems, Southern Water and Soil has partnered with the innovative company Norweco—a leading manufacturer of wastewater treatment products, systems, and chemicals sold throughout the world. Norweco specializes in small-flow treatment applications ranging from municipal treatment systems for small towns to systems for the individual family home. Their motto: “Today’s Answer for the Protection of Tomorrow’s Environment.” ![Getting Ready for Installation-s](/wp-content/uploads/2015/06/Getting-Ready-for-Installation-s.jpg) Through its alliance with Norweco, Southern Water and Soil is trained to install and maintain the Singular Green Wastewater Treatment System, an aerobic treatment unit (ATU). In essence, ATUs are mini-wastewater treatment plants that use pumps to add oxygen to the tank. The Norweco Singular Green system—the most advanced and versatile treatment system on the market—is ideal for the most difficult jobsites, where a conventional septic drainfield won’t work because of environmental obstacles such as wet soils or rocky conditions. Furthermore, at only 900 pounds, the Norweco Singular Green can be easily installed with just a backhoe. ![Commercial Norweco System-s](/wp-content/uploads/2015/06/Commercial-Norweco-System-s.jpg) Constructed of a rotationally-molded, UV-protected polyethylene tank, the Singular Green multi-chamber aerobic treatment center is assured to perform reliably for decades. **How It Works** After entering the inlet, wastewater flows into the first of three chambers—the Pretreatment Chamber—which mimics a conventional septic tank. In this section, gravity causes solid waste to settle to the tank’s bottom, while liquid waste rises. ![Norweco System with Backfill-s](/wp-content/uploads/2015/06/Norweco-System-with-Backfill-s.jpg) After being separated in the Pretreatment Chamber, untreated wastewater moves into the Aeration Chamber where safe, living aerobic bacteria convert the wastewater into stable substances. Through the use of an aerator, oxygen is added to the wastewater which creates a favorable environment for bacteria growth. ![Installed in Wet Soils-s](/wp-content/uploads/2015/06/Installed-in-Wet-Soils-s.jpg) Finally, the wastewater flows into the Clarification Chamber where it is filtered into a clarified liquid. In other words, small solids that passed through the Pretreatment Chamber are skimmed from the effluent. Then, the treated, clear, safe, and odorless liquid exits the system through the outlet for return to the environment. ![Septic Sand Backfill-s](/wp-content/uploads/2015/06/Septic-Sand-Backfill-s.jpg) Customers can also add an optional disinfection device to their Singular Green system which utilizes Norweco Blue Crystal Chlorination tablets. **Why Norweco Singular Green?** Although it runs on electricity, the aerator is economical to operate, with a quiet motor that reduces heat that dramatically increases its bearing life. In addition, the patented internal and external ribbed design of the polyethylene tank along with injection-molded risers and tamper-resistant lid fasteners assure tank integrity and minimize the potential for tank damage. The three-chamber system can treat up to 600 gallons for wastewater per day and is perfect for areas where traditional tanks cannot be used. With Norweco Singular Green you can be sure you’ll be receiving the highest in safety, reliability, and quality when compared to other wastewater treatment options. The Norweco Singular Green septic system is competitively priced and available for installation through Southern Water and Soil. Call them today for a customized wastewater treatment solution for your home or business. ### Related Posts: [## How to Design the Best Septic Drain Field for Your Home](https://southernsepticanddesign.com/septic-services-blog/how-to-design-the-best-septic-drain-field-for-your-home/) **Categories:** Septic Services Blog **Tags:** septic drain field --- ### [How to Design the Best Septic Drain Field for Your Home](https://southernsepticanddesign.com/septic-services-blog/how-to-design-the-best-septic-drain-field-for-your-home/) **Published:** February 2, 2015 **Author:** Southern Water Soil **Content:** ![septic drain field](/wp-content/uploads/2015/02/97390762-septic-drain-field-300x199.jpg)If your home is in need of a [new septic drain field](/septic-services/septic-drain-field/ "Septic Drain Field, Tampa FL"), the design of the system will determine its performance and longevity. There are multiple options for how to install a system completely from scratch or to retrofit a new septic drain field into another system where the drain field has been compromised or is otherwise non-functional. First, you need to consider how much waste your system will have to treat. Larger homes with more people will require larger systems and septic drain fields. In addition, you’ll want to consider the exact construction and placement of the various types of septic tanks that treat the waste before delivering it to the [septic drain field](/septic-services/septic-drain-field/ "Call us if you want a new septic drain field.") and how those will interact for your drain field. This may change your specific requirements for the entire system, and in some cases, a drain field may not be ideally retrofitted to an existing tank or system of tanks. Second, consider how much space you have on your property for a septic drain field, how large of an area and the proper slope that the drain field will need to cover, and your local or county regulations on septic systems, including distance from your home and from property lines or other boundaries. You’ll often need a permit from your local authority for a new septic drain field. Third, remember that a septic drain field will need to be designed to avoid large plants and the threat of heavy objects or movement over them in order to ensure its best function. At Southern Water and Soil, we aim to exceed your expectations with well-designed and cost-effective septic services. Let us help you today! ### Related Posts: [## Norweco Singular Green Wastewater Treatment System](https://southernsepticanddesign.com/septic-services-blog/norweco-treatment-system/) **Categories:** Septic Services Blog **Tags:** septic drain field --- ### [Septic Tank Design and Your Needs](https://southernsepticanddesign.com/septic-services-blog/septic-tank-design-and-your-needs/) **Published:** March 20, 2015 **Author:** Southern Water Soil **Content:** ![88014103-septic tank design](/wp-content/uploads/2015/02/88014103-septic-tank-design-199x300.jpg)If you’re installing a new septic tank or replacing an old one, there are several important things to ponder and plan before committing to a particular setup or septic tank design. Consider the average use of your system. How many people generally live in the home? Will the home ever see spikes in the number of residents or increases in usage? How many bathrooms are in the home? What type of laundry and dishwashing appliances are in the home? Are these fixtures newer and designed to use less water, or are they of an older type that uses more water? The answers to any or all of these can alter what your best septic tank design will be. Also, consider your site needs. Is there a septic tank or system already in place that needs upgrading, retrofitting, or replacement? What space exists for the septic drain field? Where is the current out point of the wastewater in your home? All of these are exterior influences on your septic tank design. With over 30 years of combined service in design, permitting, and [septic tank design](/septic-services/residential-septic-services/septic-tank-design/ "Need Help with Septic Tank Design? Contact Us Today.") and engineering, our team at Southern Water and Soil is committed to exceeding your expectations by providing properly designed septic systems that are cost-effective. Our experience in septic systems insures that we can install your system with minimal headaches. We also offer [septic system warranty packages](/septic-services/residential-septic-services/septic-tank-design/ "Septic Tank Design, Tampa FL"), so you can rest easy. Give us a call today! ### Related Posts: [## Septic Tank Design – Finding a Location](https://southernsepticanddesign.com/septic-services-blog/septic-tank-design-finding-a-location/) **Categories:** Septic Services Blog **Tags:** septic tank design --- ### [Septic Pumping: More than Meets the Eye](https://southernsepticanddesign.com/septic-services-blog/septic-pumping-more-than-meets-the-eye/) **Published:** April 3, 2015 **Author:** Southern Water Soil **Content:** ![453070089-septic pumping](/wp-content/uploads/2015/02/453070089-septic-pumping-300x225.jpg)It could be easy for [septic pumping](/septic-services/residential-septic-services/septic-pumping/ "Septic Pumping, Tampa FL") to become a punchline for homeowners. It’s rarely considered glamorous or fun, but fewer things are more necessary to the continued well-being of your home and septic system than regular septic pumping. The open secret is that septic pumping is far more than removing sludge and scum from the septic tank. Regular [septic pumping](/septic-services/residential-septic-services/septic-pumping/ "Professional Septic Pumping Services") not only allows excess biomatter to be taken out of the tank, but also for the tank and associated systems like the drain field to be inspected by a trained professional. Other issues in the waste system outside of the septic system might be impacting the function of the septic system, and a trained technician will be able to better diagnose or narrow down the problem area or issue. Major problems are easily avoided, as the minor issues that would pass by unnoticed to the untrained eye are found before they cause complications or damage to the system or the home. By proactively solving minor issues, the entire system becomes better able to deal with waste in a more efficient manner and also increases the life of the system. In addition, some local regulations require that waste pumped from a septic system be specially disposed of. At Southern Water and Septic, we’re committed to providing you with the best quality and most cost-effective service possible. We’re dedicated to you over the life of your septic system, which is why we offer assistance with septic engineering, design, installation and education. We want to exceed your expectations with residential septic services that are properly designed and installed with minimal headaches. Call us today! ### Related Posts: [## There’s No Definitive Answer about the Frequency of Septic Pumping](https://southernsepticanddesign.com/septic-services-blog/theres-no-definitive-answer-about-the-frequency-of-septic-pumping/) **Categories:** Septic Services Blog **Tags:** septic pumping --- ### [Package Wastewater Treatment System Installation](https://southernsepticanddesign.com/septic-services-blog/package-wastewater-treatment/) **Published:** January 30, 2015 **Author:** Southern Water Soil **Content:** Southern Water and Soil, Inc., is a certified onsite wastewater contractor in North Carolina and a registered septic tank contractor in Florida. Through innovative products and designs the SWS team can provide wastewater solutions for your project. In North Carolina, onsite wastewater systems that are over 3,000 gallons per day the system has to be engineered. In Florida, systems that are over 1,000 square feet of subsurface drainfield or disposal system requires engineering. SWS can provide you guidance on these systems and their requirements. SWS has installed many subsurface wastewater systems from low pressure dosing systems to subsurface drip irrigation systems. ![Advantex AX-Max Treatment System Installed in North Carolina-small](/wp-content/uploads/2015/06/Advantex-AX-Max-Treatment-System-Installed-in-North-Carolina-small.jpg) SWS provides innovative wastewater expertise that solves your wastewater problems. Through solid science and expertise SWS can provide a solution for your wastewater needs. ![Package Wastewater Plant-s](/wp-content/uploads/2015/06/Package-Wastewater-Plant-s.jpg) SWS works with engineers, soil scientists, regulators, manufacturers, and suppliers to provide a high quality wastewater installation. If you need a wastewater treatment system installed in North Carolina don’t hesitate to call SWS. We will provide you with quality installation at reasonable prices. ![Wastewater Treatment Experts in North Carolina](/wp-content/uploads/2015/06/Wastewater-Treatment-Experts-in-North-Carolina.jpg) ![Excavating and Prepping Site for Package Plant-s](/wp-content/uploads/2015/06/Excavating-and-Prepping-Site-for-Package-Plant-s.jpg) ![Advantex AX-Max Installation](/wp-content/uploads/2015/06/Advantex-AX-Max-Installation.jpg) ![Subsurface Disposal Site Preparation-s](/wp-content/uploads/2015/06/Subsurface-Disposal-Site-Preparation-s.jpg) ![Subsurface Drip Installed](/wp-content/uploads/2015/06/Subsurface-Drip-Installed.jpg) **Categories:** Septic Services Blog --- ### [How a Professional Completes a Septic Permit Application in 4 Easy Steps](https://southernsepticanddesign.com/septic-services-blog/how-a-professional-completes-a-septic-permit-application-in-4-easy-steps/) **Published:** April 17, 2015 **Author:** Southern Water Soil **Content:** While there are many important aspects of your home you should always trust to a trained professional, perhaps one of the most important is in your water and septic system. ![How a Professional Completes a Septic Permit Application in 4 Easy Steps](/wp-content/uploads/2015/04/How-a-Professional-Completes-a-Septic-Permit-Application-in-4-Easy-Steps.jpg) 1. **Know your rules.** States usually have particular sets of rules, some of which are made more stringent or have heavier requirements for specific systems depending on the location. In the case of a septic permit application, these requirements can also depend on the local water supply and environmental considerations, such as how close to open water or the local water table the septic system will be. 2. **Know your site**. Make certain that your system is engineered for best placement in relation to the property, any structures, and to the environment. This combined with the first point will make the [septic permit application process](/septic-services/residential-septic-services/septic-permit-application/ "Septic Permit Application, Tampa FL") simpler, easier, and speed the approval of the system. 3. **Know which forms are needed for approval.** Knowing exactly which forms and schematics must be submitted with the septic permit application is the key to its approval. Work generally cannot begin until the plans are submitted and approved. It’s always best to have the permit application done as early as possible in order to allow for whatever delays may occur. 4. **Experience leads to success.** A professional has done this all before and has more experience designing successful systems that meet or exceed all legal requirements without breaking your bank account. At Southern Water and Septic, we specialize in cost-effective engineered solutions to your water and septic needs. Let us help you with your [septic permit application](/septic-services/residential-septic-services/septic-permit-application/ "Contact Us for a Hassle-Free Septic Permit Application") today! ### Related Posts: [## Why Do I Need a Septic Permit Application?](https://southernsepticanddesign.com/septic-services-blog/why-do-i-need-a-septic-permit-application/) **Categories:** Septic Services Blog **Tags:** septic permit application --- ### [Septic Engineering for Success and Ease of Maintenance](https://southernsepticanddesign.com/septic-services-blog/septic-engineering-for-success-and-ease-of-maintenance/) **Published:** May 15, 2015 **Author:** Southern Water Soil **Content:** ![464986313-Septic Engineering](/wp-content/uploads/2015/02/464986313-Septic-Engineering-300x199.jpg)Septic engineering can mean different things to different people. For some, it seems extravagant and unnecessary. For others, they’ve realized than an engineered solution to their septic need will greatly increase the longevity and durability of the entire system, resulting in lower maintenance and ownership costs. The key focus on [septic engineering](/septic-services/septic-engineering/ "Septic System Design, Tampa FL") is designing a system that best deals with the flow of waste generated by the site. In a residential situation, this is often calculated by how many bedrooms are in the home. Whether this is a seasonal home or for year-round use is also a consideration in septic engineering — a larger family living in a place year-round will generate more wastewater and demand on the system when compared to a single person or couple who uses this residence seasonally. Another important consideration in the septic engineering calculation is how many bathrooms and plumbing fixtures are in the home. These will in turn determine the minimum size of tank and the size of the drainage field. State and local regulations vary widely in how to count the number of fixtures, so it’s best to have the number of fixtures and their types in mind. Another focus of septic engineering is the drainage field. Type of soil, elevation, and proximity to a high water table or areas of open water can alter the calculations of the size of the drainage field. Soil type is used to calculate how effluent can be absorbed in a 24-hour period. At Southern Water and Soil, we’re committed to quality and cost-efficient [septic engineering](/septic-services/septic-engineering/ "Contact Us Today for All Your Septic Tank Design Needs"), education, and installation. Give us a call today! ### Related Posts: [## Quick Design Elements That Will Save Your Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/quick-design-elements-that-will-save-your-septic-engineering/)[## Defining Septic Engineering: Four Important Factors](https://southernsepticanddesign.com/septic-services-blog/defining-septic-engineering-four-important-factors/)[## The Three P’s of Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/the-three-ps-of-septic-engineering/) **Categories:** Septic Services Blog **Tags:** Septic Engineering --- ### [Why Aerobic Septic Systems “Work Out”](https://southernsepticanddesign.com/septic-services-blog/why-aerobic-septic-systems-work-out/) **Published:** September 17, 2015 **Author:** Southern Water Soil **Content:** Aerobic septic systems are a [relatively new addition to the world of septic](/septic-systems/aerobic-septic-systems/) treatment solutions. These aerobic treatment systems utilize a number of different methods to break down waste and wastewater into an effluent that is generally of much higher quality than the effluent from a traditional anaerobic septic system. Because of this, the effluent from an aerobic system can be sterilized and used for surface irrigation, or the size of the drain field can be decreased because of the higher quality of the effluent. Aerobic septic systems are great for smaller lots without much space for a drain field, as well as areas where water use and re-use is a concern and priority. ![Why Aerobic Septic Systems “Work Out”](/wp-content/uploads/2015/09/Why-Aerobic-Septic-Systems-Work-Out-resized.jpg) ![Aerobic Septic Systems](/wp-content/uploads/2015/08/52-300x146.png)The precise number of processes in aerobic septic systems depends on the exact nature of the system, the wastewater load it is expected to handle, the soil and terrain of the site, and whether the final effluent will be sent to a drain field or further sterilized for reuse in irrigation. The aerobic treatment systems usually have four principal steps. First, a pre-treatment stage removes large solids and other undesirable substances from waste water; this is the most similar to a traditional anaerobic septic system. The second stage is the key aeration stage, where waste water passes through a space in which aerobic bacteria are alternately exposed to the waste water and to air, allowing them to further break down biological wastes in the water. The precise method varies from system to system, and aeration stages can be added to existing septic systems to improve overall function, counter system degradation, or increase the overall capacity of the system. A settling stage follows the aeration stage, allowing undigested solids to settle. These wastes will periodically need to be cleaned from the system to ensure proper long-term function of the [entire aerobic septic system](/septic-systems/aerobic-septic-systems/). The last stage, which is optional, is a disinfecting stage during which chlorine or another disinfectant is mixed with the water to make an output that is antiseptic. The end of this process results in effluent that is easier for the soil to absorb and easier on the environment. At Southern Water and Soil, we are dedicated to helping our customers find and implement the best solutions for all of their septic system needs. Please contact us today for more information. ### Related Posts: [## Taking Your Septic to the Next Level with Aerobic Septic Systems](https://southernsepticanddesign.com/septic-services-blog/taking-your-septic-to-the-next-level-with-aerobic-septic-systems/) **Categories:** Septic Services Blog **Tags:** aerobic septic systems --- ### [Engineered Septic System Design in Florida](https://southernsepticanddesign.com/septic-services-blog/engineered-septic-system-design-in-florida/) **Published:** June 18, 2015 **Author:** Southern Water Soil **Content:** Southern Water and Soil, Inc., is a licensed engineering firm specializing in engineered septic systems in the State of Florida. Also an added bonus is that SWS is a licensed Septic Tank Contractor. Therefore, you get a company that can give you a soup to nuts project proposal. Also, SWS can provide you with the best septic solutions for your specific septic system needs. If you are looking for alternative septic systems (i.e., aerobic treatment units, drip irrigation system, No-Mound Systems, Norweco, Orenco, Advantex, Clearstream, Geoflow, Hoot) or if a septic drainfield is over 1,000 square feet the system has to be designed by an engineer. If a drip irrigation system is utilized it has to be designed by an engineer. Southern Water and Soil can provide cost effective septic designs and engineered septic designs. ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/100_1023-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/100_1024-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/100_1114-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/100_1122-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00176-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00177-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00178-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00421-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC00471-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC006421-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/DSC01046-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/fifththirdbank-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/lowpressuredosing-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/P7280059-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/P7280061-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/P7280063-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/P8120002-150x150.jpg) ![](https://southernsepticanddesign.com/wp-content/uploads/2015/06/Xerxes-Tank-150x150.jpg) ### Related Posts: [## Why Septic System Design is Important to Get Right](https://southernsepticanddesign.com/septic-services-blog/why-septic-system-design-is-important-to-get-right/)[## Size is a Crucial Element of Septic System Design](https://southernsepticanddesign.com/septic-services-blog/size-is-a-crucial-element-of-septic-system-design/)[## The Right Septic System Design Can Make All the Difference for Your Home or Business](https://southernsepticanddesign.com/septic-services-blog/the-right-septic-system-design-can-make-all-the-difference-for-your-home-or-business/) **Categories:** Septic Services Blog **Tags:** septic system design --- ### [Septic System Design and Your Property](https://southernsepticanddesign.com/septic-services-blog/septic-system-design-and-your-property/) **Published:** October 16, 2015 **Author:** Southern Water Soil **Content:** Septic system design is not something most people think about very often. However, good septic system design principles can give you a [long-lasting, effective, and responsive septic system](/septic-systems/septic-system-design/) that will cause less stress and cost less over the long term. ![Septic System Design and Your Property](https://southernsepticanddesign.com/wp-content/uploads/2015/10/Septic-System-Design-and-Your-Property-resized.jpg) ![Septic System Design](/wp-content/uploads/2015/08/53-300x300.jpg) - **Location** – Where will the system be installed? Considering where on the property the tank and the drain field will be placed is extremely important. Consider where wastewater leaves the building, where the drain field is best placed for drainage, and the distance from the septic tank to the drain field, as well as the type of soil on the property and the necessary size of the drainage field. Good septic system design will also take into account any slope that might be on the property, as well as the relationship to other properties and the local water table. - **Regulation** – What permits and regulations are needed to install, retrofit, or alter an existing septic system? These can vary greatly, so it’s essential to submit fully realized and carefully prepared plans to the local office responsible for approval. Plans prepared in this way face fewer delays and less chance of rejection or modification. - **Implementation** – Even the best septic system design means nothing if the plans aren’t executed according to specification. Working with an experienced firm like Southern Water and Soil will benefit your project, your property, and the environment. At Southern Water and Soil, we have years of experience not only in [septic system design](/septic-systems/septic-system-design/), but also in helping people improve the quality as well as the quantity of their water. We work with you to find the best solution for your particular needs. ### Related Posts: [## The Right Septic System Design Can Make All the Difference for Your Home or Business](https://southernsepticanddesign.com/septic-services-blog/the-right-septic-system-design-can-make-all-the-difference-for-your-home-or-business/)[## Engineered Septic System Design in Florida](https://southernsepticanddesign.com/septic-services-blog/engineered-septic-system-design-in-florida/)[## Why Septic System Design is Important to Get Right](https://southernsepticanddesign.com/septic-services-blog/why-septic-system-design-is-important-to-get-right/) **Categories:** Septic Services Blog **Tags:** septic system design --- ### [Important Septic Engineering Considerations](https://southernsepticanddesign.com/septic-services-blog/important-septic-engineering-considerations/) **Published:** November 17, 2015 **Author:** Southern Water Soil **Content:** When planning a new septic system or improvements to an existing one, [septic engineering is critical](/septic-services/septic-engineering/) to not only the integrity of the system, but also making sure that it interacts beneficially with the home or business it serves, as well as the environment. Important septic engineering considerations will take into account the best practices in waste treatment, as well as the needs and water usage of the site, the soil on the site, the presence and distance of the water table from the drain field, any applicable laws or regulations on the placement and operation of septic systems, and any other particular needs or requirements of the site. ![Important Septic Engineering Considerations](/wp-content/uploads/2015/11/Important-Septic-Engineering-Considerations-resized.jpg) ![Septic Engineering](/wp-content/uploads/2015/08/54-300x169.jpg)The first consideration of septic engineering is the relationship between the septic tank and the structure. In general, it’s important to have the tank close to the wastewater exit from the house. Changes over time in water table or water usage might cause issues if the tank isn’t properly sited or if the amount of waste water increases beyond the ability of the tank to safely handle it. Adding an aerobic septic component to an existing system requires some septic engineering, but can help a system struggling to process the volume of waste water, as well as microbe growth in the drain field. Siting, preparing, and installing a drain field is the second important consideration in septic engineering. Without proper work here, the drain field will not be able to properly disperse the effluent over the entire drain field area and can clog, back up, or lead to unwanted biomat growth. It’s important to site the drain field in a place devoid of vehicular traffic and away from trees or shrubs that might attempt to grow into the drain field looking for an easy water source. At Southern Water and Soil, [we have years of experience](/septic-services/septic-engineering/) in septic engineering for residential and commercial clients, and we are dedicated to improving the quality and quantity of water for our clients while helping to preserve the environment. Please contact us for more information. ### Related Posts: [## Septic Engineering for Success and Ease of Maintenance](https://southernsepticanddesign.com/septic-services-blog/septic-engineering-for-success-and-ease-of-maintenance/)[## The Importance of Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/the-importance-of-septic-engineering/)[## We Are Equipped to Assist With Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/we-are-equipped-to-assist-with-septic-engineering/) **Categories:** Septic Services Blog **Tags:** Septic Engineering --- ### [Our septic tank installations were recently featured in Onsite Installer!](https://southernsepticanddesign.com/septic-services-blog/our-septic-tank-installations-were-recently-featured-in-onsite-installer/) **Published:** November 26, 2015 **Author:** Southern Water Soil **Content:** ![septic tank installations](https://southernsepticanddesign.com/wp-content/uploads/2015/11/2014-05-31-21.28.181-300x300.jpg)At Southern Water and Soil, we do [customized septic tank installations](/septic-services-tampa-fl/residential-septic-services/septic-tank-installations/) at homes and businesses in Tampa, Florida and beyond. Recently, *Onsite Installer* featured us in their publication and talked a little bit about our business and how we fit into a niche market. The piece starts off by talking about how we got started, and how Greg Mayfield, our founder, made the decision to start up Southern Water and Soil back in 2005. One of our favorite parts of the article is when it talks about how during the recession, we were able to keep our operations afloat by selling jobs for a local family that replaced drain fields in RV parks. Another highlight of this article is how it takes you on a journey from where we started to where we are today doing large commercial jobs as well as smaller [septic tank installations on residential properties](/septic-services-tampa-fl/residential-septic-services/septic-tank-installations/). In the article, our founder takes a minute to thank his employees by saying, “I credit my trusted employees for my success. They never take shortcuts and are vested in this company and its advancement.” Although the economy may still be a little slow, we are excited for our future growth and where we will be 10 years from now. If you haven’t read the full article yet, make sure you take a few minutes to look through it. As always, please don’t hesitate to contact us at Southern Water and Soil if you have questions about septic tank installations or any of our other services. [![cover](https://southernsepticanddesign.com/wp-content/uploads/2014/07/cover-249x300.jpg)](https://southernsepticanddesign.com/wp-content/uploads/2015/11/i0815_Profile_ATailoredFit.pdf) **Categories:** Septic Services Blog **Tags:** septic tank installations --- ### [What to Know and Ask About Your Commercial Septic Permit Application](https://southernsepticanddesign.com/septic-services-blog/what-to-know-and-ask-about-your-commercial-septic-permit-application/) **Published:** December 17, 2015 **Author:** Southern Water Soil **Content:** A commercial septic permit application is required in many areas before construction can begin. [Knowing the process for your area](/septic-services-tampa-fl/residential-septic-services/septic-permit-application/) is important to the approval of the plan, keeping construction or repair work on-time and under budget, and creating a system that is able to handle the required load for many years without fail. ![What to Know and Ask About Your Commercial Septic Permit Application](/wp-content/uploads/2015/12/What-to-Know-and-Ask-About-Your-Commercial-Septic-Permit-Application-resized.jpg) ![Commercial Septic Permit Application](/wp-content/uploads/2015/08/55-300x179.jpg)Before construction, it’s necessary to determine whether a commercial septic permit application exists for your city or county, as well as the zoning regulations for your particular property. Most areas will have many, if not all, of the required forms available online, or a quick call or visit to the responsible city or county department can help you make sure you have all the needed forms. Ask your local officials what the best way is to prepare and file these applications. Because of the greater public use and heavier wastewater generation of commercial septic systems, it’s best to work with a group that understands the needs of your particular area and has prior expertise in this particular subset of septic systems. If you have a good estimate of the amount of wastewater you expect to generate, the size of the tank, drain field, the use of an aerobic septic system, etc., you can determine how to integrate the commercial septic system into the larger commercial property. Drawing up detailed plans to submit along with the commercial septic permit application is more likely to gain approval and require fewer, if any, adjustments or redrawing of plans. Ask your contractor if they assist their clients in preparation of the diagrams and other materials necessary for a commercial septic permit application. At Southern Water and Soil, we have years of experience in helping our clients improve the quality and quantity of their water. We’re committed not only to our customers and each individual need, but also to safeguarding our precious natural resources for the good of our planet and for our future generations. **Categories:** Septic Services Blog **Tags:** Commercial Septic Permit Application --- ### [The Right Septic System Design Can Make All the Difference for Your Home or Business](https://southernsepticanddesign.com/septic-services-blog/the-right-septic-system-design-can-make-all-the-difference-for-your-home-or-business/) **Published:** February 17, 2016 **Author:** Southern Water Soil **Content:** ![Septic System Design](/wp-content/uploads/2015/12/from-dropbox-Septic-System-Design-300x179.jpg)If your home or business is not located near a waste processing facility, you may not have the option of installing a sewer line. In cases like this, a septic system is usually the best option. If you are considering having a septic system installed on your property, be sure to [hire a professional](/septic-systems-tampa-fl/septic-system-design/) to create the septic system design. ![The Right Septic System Design Can Make All the Difference for Your Home or Business](https://southernsepticanddesign.com/wp-content/uploads/2016/02/THE-RIGHT-SEPTIC-SYSTEM-DESIGN-CAN-MAKE-ALL-THE-DIFFERENCE-FOR-YOUR-HOME-OR-BUSINESS-resized.jpg) The size and layout of your septic system will be determined by a number of factors. For one thing, you need to think about the number of bathrooms in your home or business. If you have a modestly sized home with one or two bathrooms, a small septic tank may be sufficient. If you own an office building or apartment complex, however, you will need a much bigger system to accommodate all of the bathrooms. In addition to considering the number of bathrooms on your property, there are a few more components that go into a septic system design. Septic systems work by filtering water and waste first through the septic tank and then through the septic drain field and back into the environment. Some septic systems use gravity to transport the materials, while others use a pump to pressurize and transport the materials. If your property is sloped, or if it is large enough to dig deep into the ground, a gravity system might work. If your property will not allow for the drain field to be at a lower elevation than the septic tank, however, a pressurized system might be your best bet. Having a septic system installed is no easy task, and it is very important that the [job be done properly](/septic-systems-tampa-fl/septic-system-design/) the first time. To make sure that your septic system installation goes off without a hitch, hire a professional septic engineer from our team at Southern Water and Soil to create your septic system design. ### Related Posts: [## Size is a Crucial Element of Septic System Design](https://southernsepticanddesign.com/septic-services-blog/size-is-a-crucial-element-of-septic-system-design/)[## Septic System Design and Your Property](https://southernsepticanddesign.com/septic-services-blog/septic-system-design-and-your-property/)[## Why Septic System Design is Important to Get Right](https://southernsepticanddesign.com/septic-services-blog/why-septic-system-design-is-important-to-get-right/) **Categories:** Septic Services Blog **Tags:** septic system design --- ### [Hire a Professional for Your Commercial Septic Tank Installation](https://southernsepticanddesign.com/septic-services-blog/hire-a-professional-for-your-commercial-septic-tank-installation/) **Published:** April 18, 2016 **Author:** Southern Water Soil **Content:** ![Commercial Septic Tank Installation ](/wp-content/uploads/2015/12/from-dropbox-Commercial-Septic-Tank-Installation-300x169.jpg)When it comes to commercial septic tank installation, there are several key factors to consider. You need to not only choose the right size septic tank, but also the right size and configuration for your septic drain field. The best way to ensure that the [components of your septic system](/commercial-septic-tampa-fl/commercial-septic-tank-installations/) work together is to have it professionally designed and installed. ![Hire a Professional for Your Commercial Septic Tank Installation](https://southernsepticanddesign.com/wp-content/uploads/2016/04/HIRE-A-PROFESSIONAL-FOR-YOUR-COMMERCIAL-SEPTIC-TANK-INSTALLATION-resized.jpg) Commercial septic tanks are usually larger than residential septic tanks because they have a larger volume of waste to handle. Whereas a home might only have one or two bathrooms, a business could have six, eight, or a dozen bathrooms—maybe more. You also have to take into account the number of sinks in the building, as well as any laundry facilities. Each time one of your employees flushes the toilet or runs a sink, the waste and some of the water will flow into your septic system for processing. In addition to making sure that your septic system is sized appropriately for your business, you also want to be sure it is made from high-quality materials, so it will last. Commercial septic tank installation involves digging holes into the property to bury the components, which means they won’t be easy to access for repairs. Investing in high-quality and durable materials will help to prevent the need for frequent repairs and replacements. At Southern Water and Soil, we have experience dealing with all of the most popular septic tank brands and designs. If you need to hire someone to [perform your commercial septic tank installatio](/commercial-septic-tampa-fl/commercial-septic-tank-installations/)n, make us your first call. ### Related Posts: [## What to Expect During Your Commercial Septic Tank Installation](https://southernsepticanddesign.com/septic-services-blog/what-to-expect-during-your-commercial-septic-tank-installation/) **Categories:** Septic Services Blog **Tags:** Commercial Septic Tank Installation --- ### [Make an Appointment Today for Drip Irrigation System Installation](https://southernsepticanddesign.com/septic-services-blog/make-an-appointment-today-for-drip-irrigation-system-installation/) **Published:** May 16, 2016 **Author:** Southern Water Soil **Content:** ![Drip Irrigation System Installation](/wp-content/uploads/2015/12/from-dropbox-Drip-Irrigation-System-Installation-300x169.jpg)Drip irrigation systems are some of the simplest yet most effective methods of water delivery for residential and commercial landscaping. If you are thinking about having a drip irrigation system installed outside your home or business, make our team at Southern Water and Soil your first call. ![Make an Appointment Today for Drip Irrigation System Installation](/wp-content/uploads/2016/05/MAKE-AN-APPOINTMENT-TODAY-FOR-DRIP-IRRIGATION-SYSTEM-INSTALLATION-resized.jpg) If you are tired of spending hours each week watering your flowers, shrubs, and plants by hand, then a **drip irrigation system installation** may be just what you need. Drip irrigation systems make the work of keeping your landscaping in prime condition quick and easy—all you have to do is turn on the water supply. These systems can be installed quickly and are highly flexible and usable for container gardens, as well as raised beds, shrubbery, flower beds, and more. Our systems can also be adjusted as your landscaping grows and changes. A drip irrigation system consists of a water line connected to multiple emitters, which discharge the water from your hose spigot directly into your landscaping where you need it most. Having your Tampa, Florida drip irrigation system installed by our team at Southern Water and Soil ensures that your system will be customized perfectly to suit your landscaping design. Best of all, the system components can be concealed within your landscaping, so all your guests or customers see is your beautiful landscaping design. To have a drip irrigation system installed in your residential or commercial landscaping, contact us at Southern Water and Soil. We offer free quotes on drip irrigation system installation, with flexible weekday hours to fit your schedule. Simply give us a call, and before you know it, we will have one of our experts answering all of your questions about **drip irrigation system installation.** **Categories:** Septic Services Blog **Tags:** Drip Irrigation System Installation --- ### [Alternative Drain Field Options](https://southernsepticanddesign.com/septic-services-blog/alternative-drain-field-options/) **Published:** June 16, 2016 **Author:** Southern Water Soil **Content:** ![Drain Field Options](/wp-content/uploads/2016/06/Drain-field-photo_resized-300x169.jpg) You’ve never been the type of person to follow the crowd. You’ve always liked to go your own way, even when it comes to choosing between your drain field options. If you want to go with an alternative option, you have a lot of great choices. Let’s look at two of your best options. ![Alternative Drain Field Options](https://southernsepticanddesign.com/wp-content/uploads/2016/06/ALTERNATIVE-DRAIN-FIELD-OPTIONS-resized.jpg) **Gravelless Systems** Gravelless systems are the most popular of the alternative drain field options. This is often a [cost-effective option](/septic-services-tampa-fl/septic-drain-field/), and it is relatively easy to transport and handle. Gravelless systems are also easy on soil and a cinch to maintain. If you want to enjoy all of these benefits, ask our team at Southern Water and Soil about our gravelless systems. **Chamber Systems** If you want to go with one of the unique drain field options, a chamber system might be just what you’re looking for. These systems have open-bottomed pipes. Because they are so [easy to install](/septic-services-tampa-fl/septic-drain-field/drain-field-options/), our technicians can get them in with less damage to the landscaping. They typically cost less than a traditional drain field does, too, so keep that in mind. Of course, one of our technicians would be happy to come out and give you a quote on a chamber system. Then, you will have a better idea if this type of drain field is the right choice for you. Now that you know some of your alternative drain field options, you can start to think about what you want out of your system. Then, you can contact us at Southern Water and Soil to schedule an estimate. Once we agree on a price, we can design your drain field for you. ### Related Posts: [## Drain Field Options for Your Commercial Septic Drain Field](https://southernsepticanddesign.com/septic-services-blog/drain-field-options-for-your-commercial-septic-drain-field/) **Categories:** Septic Services Blog **Tags:** Drain Field Options --- ### [What’s Involved in a Drain Field Design?](https://southernsepticanddesign.com/septic-services-blog/whats-involved-in-a-drain-field-design/) **Published:** July 15, 2016 **Author:** Southern Water Soil **Content:** ![Drain Field Design](/wp-content/uploads/2016/06/2012-10-22-09.56.16_resized-300x179.jpg)You might think that drain fields just come out of nowhere. You order a drain field for your septic system, and then it magically appears. In reality, drain fields are specially designed. When you choose to hire our team at Southern Water and Soil, our drain field design technicians will create a drain field just for your system. We consider several things when designing a drain field, such as: ![What’s Involved in a Drain Field Design?](https://southernsepticanddesign.com/wp-content/uploads/2016/07/WHAT’S-INVOLVED-IN-A-DRAIN-FIELD-DESIGN-resized.jpg) - **Type of Drain Field-** First, we must determine the right type of drain field for your needs. We will go over your options with you. You can choose a [conventional drain field](/septic-services-tampa-fl/septic-drain-field/), or go with a gravelless or chamber system. Once you decide which type of system you want, we will be ready to move on to the next step. - **Size-** Size is very important when it comes to the drain field. If the technicians fail to size the drain field correctly, it won’t absorb the effluent properly. That is why it is essential that you choose a [skilled drain field design team](/septic-services-tampa-fl/septic-drain-field/drain-field-design/) when getting a new drain field. Our drain field design team will make sure that your drain field is the right size for your needs. - **Lift Station-** Our drain field design team also needs to determine if you need a lift station. If you do need one, that needs to be a part of the design. If you don’t, then the system will use gravity to move the effluent through to the drain field. Our drain field design team at Southern Water and Soil has the skills necessary to design your next drain field. If you want to get it right the first time, it makes sense to go with us. ### Related Posts: [## Three Important Considerations for Drain Field Design](https://southernsepticanddesign.com/septic-services-blog/three-important-considerations-for-drain-field-design/)[## How to Add Some Flexibility into Your Drain Field Design](https://southernsepticanddesign.com/septic-services-blog/how-to-add-some-flexibility-into-your-drain-field-design/) **Categories:** Septic Services Blog **Tags:** Drain Field Design --- ### [Septic Tank Design – Finding a Location](https://southernsepticanddesign.com/septic-services-blog/septic-tank-design-finding-a-location/) **Published:** August 15, 2016 **Author:** Southern Water Soil **Content:** Part of a proper septic tank design plan is finding a site for the septic tank to sit. While this is often overlooked, the failure to find the right site will make it impossible for the system to work properly. Take a look at what goes into finding the right site. Then, you will be close to having a septic tank design plan in place. ![Septic Tank Design – Finding a Location](/wp-content/uploads/2016/08/SouthernWaterSoil_R2.png) - **![Septic Tank Design – Finding a Location](https://southernsepticanddesign.com/wp-content/uploads/2016/08/SEPTIC-TANK-DESIGN-FINDING-A-LOCATION-resized-1-300x300.jpg)Proximity to Water-** Your septic tank’s proximity to water is very important. You need to keep it a [safe distance from drinking water](/septic-services-tampa-fl/residential-septic-services/), or you could contaminate your water supply. Generally, it should be at least 75 feet from your source of drinking water. In addition, it needs to be at least 75 feet from natural water sources and 2-10 feet from all of your water lines. - **Proximity to Trees-** Trees and shrubs can damage your septic tank. That’s why a good septic tank design plan places the septic tank [away from trees and shrubbery.](/septic-services-odessa-fl/residential-septic-services/septic-tank-design/) - **Open Space-** You also need to choose a space that is open, so you can expand the drain field if you need to after your septic system is installed. You might add to your family and have to expand it at some point, and you don’t want to have to move your septic tank or completely redesign your system because of it. When you choose our team at Southern Water and Soil for your septic tank design needs, you don’t have to worry about a thing. We take care of it all for you, so all of your design needs are met. ### Related Posts: [## Septic Tank Design and Your Needs](https://southernsepticanddesign.com/septic-services-blog/septic-tank-design-and-your-needs/) **Categories:** Septic Services Blog **Tags:** septic tank design --- ### [The Importance of Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/the-importance-of-septic-engineering/) **Published:** October 14, 2016 **Author:** Southern Water Soil **Content:** You want to call a septic company, order a septic system, and have it installed tomorrow. While it can be done, it’s a big mistake. You’ll be skipping a very important step. You need to go through the septic engineering process in order to get the system you need to meet your needs. Fortunately, at Southern Water and Soil, we can do it all, from septic engineering all the way to installation. ![The Importance of Septic Engineering](/wp-content/uploads/2016/10/The-Importance-of-Septic-Engineering-resized.jpg) ![Septic Engineering](/wp-content/uploads/2016/06/2012-01-26-13.34.57_resized-300x179.jpg) - **Determine the Size-** One size doesn’t fit all with septic systems. We will start by determining the size you need for your system. We will look at the size of your property, as well as how many people live onsite and how much waste your family produces. That will help our septic engineering team [determine how big of a septic system you need.](/septic-services-tampa-fl/) - **Consider Zoning Requirements-** Zoning requirements are also important. We make sure that everything is up to code during the septic engineering process. That way, there won’t be any delays during the installation. We want to [make sure the installation goes off without a hitch](/septic-services-tampa-fl/septic-engineering/), and that is not possible unless everything is up to code and all of the regulations are met. If you’re serious about getting the right septic tank for your needs, it all starts with professional septic engineering. Let our septic engineers at Southern Water and Soil take the lead and design a system that will meet your demand and exceed your expectations. Then, you won’t have to worry about your system letting you down. ### Related Posts: [## Septic Engineering for Success and Ease of Maintenance](https://southernsepticanddesign.com/septic-services-blog/septic-engineering-for-success-and-ease-of-maintenance/)[## We Are Equipped to Assist With Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/we-are-equipped-to-assist-with-septic-engineering/)[## Important Septic Engineering Considerations](https://southernsepticanddesign.com/septic-services-blog/important-septic-engineering-considerations/) **Categories:** Septic Services Blog **Tags:** Septic Engineering --- ### [Cluster Wastewater Treatment Offers Alternatives](https://southernsepticanddesign.com/septic-services-blog/cluster-wastewater-treatment-offers-alternatives/) **Published:** April 14, 2017 **Author:** Southern Water Soil **Content:** ![Cluster Wastewater Treatment](/wp-content/uploads/2017/04/iStock-138071372-300x244.jpg)While large-scale sewer systems are fairly common across the United States today, sometimes they aren’t the best solution for communities that are not able to connect to these wastewater treatment systems efficiently or effectively. So, what alternatives are available to those who require a unique solution for their wastewater treatment needs? One option that has quickly become advantageous and is growing in popularity is cluster wastewater treatment systems. Here are a few situations in which [cluster wastewater treatment ](/package-plant-installations-cornelius-nc/cluster-wastewater-treatment/)may be ideal: - **Small Communities** – Often small communities can be overrun with the industrialization that comes with adding a full-scale, public sewer system. Cluster wastewater treatment may allow communities to maintain their identity while managing and maintaining a wastewater treatment system that works well for their needs. - **Space Preservation** – Because housing is the largest consumer of land, finding solutions for wastewater treatment has become an essential item. Traditional septic systems often take up a lot of land and require “large lot zoning” in order to be most effective. Cluster wastewater treatment effectively allows land developers to build their desired housing and commercial facilities without worrying that their septic system will take up too much space. - **Sustainable Development** – Cluster wastewater treatment has also proven useful in instances where development projects have been proposed, but [connecting to the public wastewater system](/package-plant-installations-cornelius-nc/cluster-wastewater-treatment/) is not viable. Implementing cluster wastewater treatment systems may offer the opportunity for communities to grow while also providing sustainable wastewater treatment options for residents and businesses. At Southern Water and Soil, we can help you determine whether cluster wastewater treatment would be a good solution for your community, and we can also assist with required maintenance. Contact us today to learn more. **Categories:** Septic Services Blog **Tags:** Cluster Wastewater Treatment --- ### [Three Reasons to Include Septic Alarms in Your Initial System Design](https://southernsepticanddesign.com/septic-services-blog/three-reasons-to-include-septic-alarms-in-your-initial-system-design/) **Published:** June 15, 2017 **Author:** Southern Water Soil **Content:** ![Septic Alarms](/wp-content/uploads/2017/04/iStock-501328696-300x300.jpg)If you are in the process of designing and installing a new septic system, you may be wondering whether septic alarms are worth the investment. In reality, septic alarms are probably one of the most critical and essential items you should include in your initial septic system design and installation. Here are three reasons why: 1. **More Control** – With [septic alarms](/septic-services-brandon-fl/septic-alarms/), you can set accurate timers and know that you’ll be warned if a septic problem ever occurs. This not only gives you more control over your septic system as a whole, but also greater peace of mind. 2. **Easier Maintenance** – Septic alarms are ideal for improved septic system maintenance. You’ll receive early alerts when something is amiss, making it easier for you to call in the professionals to address minor problems before they become major concerns. 3. **Avoid Concerns** – Knowing that you can [avoid concerns with your septic system ](/septic-services-brandon-fl/septic-alarms/)at the outset is the best way to achieve a long-lasting system for your home or business. Asking your septic professionals for recommendations of the best septic alarms prior to installation will ensure that you get the most from your alarm and your septic system for years to come. If you have questions about septic alarms or are ready to begin septic design, you can rely on us at Southern Water and Soil for all your septic system needs. With years of experience working on residential and commercial systems, we are equipped to provide you with the services you require. Call us today to get started. **Categories:** Septic Services Blog **Tags:** Septic Alarms --- ### [We Are Equipped to Assist With Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/we-are-equipped-to-assist-with-septic-engineering/) **Published:** July 14, 2017 **Author:** Southern Water Soil **Content:** ![Septic Engineering](/wp-content/uploads/2017/04/iStock-500883012-300x300.jpg)Although septic systems are fairly common, there may be instances in which you need professional assistance with septic engineering due to the size and scope of your building project. At Southern Water and Soil, we understand that having a high-quality septic system is an essential part of your residential or commercial development projects, and we have years of experience providing the services needed to get the best results. So, when you have a [septic engineering](/septic-services-tampa-fl/septic-engineering/) request or concern, our team is ready and able to help you get the job done right. With our septic engineering services, we are able to assist with smaller-scale projects, like residential housing developments, as well as larger projects, such as commercial building sites or farm land operations. We can also provide alternatives to traditional aerobic systems with the construction of cluster wastewater treatment systems and drip irrigation. With our background in a variety of residential and commercial septic projects, you can rely on us for the recommendations, servicing, and quality septic engineering you expect from a professional septic company. We will work with you every step of the way to ensure that you meet your [wastewater management goals](/septic-services-tampa-fl/septic-engineering/). If you have questions about how we can assist you with septic engineering or if you would like to schedule an estimate, contact us at Southern Water and Soil today for more information. We also provide septic inspections and complete septic design services to ensure that you get the best results from your septic system year after year. We look forward to working with you. ### Related Posts: [## Septic Engineering for Success and Ease of Maintenance](https://southernsepticanddesign.com/septic-services-blog/septic-engineering-for-success-and-ease-of-maintenance/)[## Quick Design Elements That Will Save Your Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/quick-design-elements-that-will-save-your-septic-engineering/)[## Defining Septic Engineering: Four Important Factors](https://southernsepticanddesign.com/septic-services-blog/defining-septic-engineering-four-important-factors/) **Categories:** Septic Services Blog **Tags:** Septic Engineering --- ### [Three Important Considerations for Drain Field Design](https://southernsepticanddesign.com/septic-services-blog/three-important-considerations-for-drain-field-design/) **Published:** August 15, 2017 **Author:** Southern Water Soil **Content:** ![Drain Field Design](/wp-content/uploads/2017/04/iStock-467926653-300x199.jpg)When it comes to building your septic system, your drain field is an essential component and must be accounted for wisely. So, what do you have to consider when it comes to drain field design before the installation takes place? Here are three important factors that will affect your [drain field design](/septic-services-tampa-fl/septic-drain-field/drain-field-design/) and the installation process. 1. **Location** – Your septic drain field is perhaps one of the largest parts of your septic system overall. That means it takes up a lot of space and will need a large area to accommodate it fully. Whether you are building a new home or commercial businesses, knowing where your drain field will go as part of your building project will ensure you get the best results. 2. **Size** – Along with location, your drain field design must also[ take into account the size of the drain field itself.](/septic-services-tampa-fl/septic-drain-field/drain-field-design/) This is important for two reasons: firstly, you’ll want to make sure your drain field is able to handle the amount of wastewater that comes through, and secondly, you’ll want a drain field that will provide long-lasting operation for your property. 3. **Soil** – The last factor that comes into play with your drain field design is the soil, which must be able to handle the filtering of wastewater back into the ground safely and effectively. Making sure you have the proper soil types for your drain field before installation will ensure that you get the best results from your septic system as a whole. At Southern Water and Soil, we can assist you with your drain field design, including determining the best location, the most efficient size, and whether your soil is ideal. We can also address all of your other residential and commercial septic components before, during and after installation. Contact us today if you require septic services, and we will be happy to assist you. ### Related Posts: [## How to Add Some Flexibility into Your Drain Field Design](https://southernsepticanddesign.com/septic-services-blog/how-to-add-some-flexibility-into-your-drain-field-design/)[## What’s Involved in a Drain Field Design?](https://southernsepticanddesign.com/septic-services-blog/whats-involved-in-a-drain-field-design/) **Categories:** Septic Services Blog **Tags:** Drain Field Design --- ### [Defining Septic Engineering: Four Important Factors](https://southernsepticanddesign.com/septic-services-blog/defining-septic-engineering-four-important-factors/) **Published:** September 15, 2017 **Author:** Southern Water Soil **Content:** ![septic engineering](/wp-content/uploads/2017/08/iStock-500883012-300x300.jpg)Many people have heard of septic system design and know the basic parts of a septic system if they have one at their home. The term septic engineering, however, may be a little bit vaguer and leave someone with questions about what exactly it means or involves. In fact, septic engineering is the process of[ designing a septic system](/septic-services-tampa-fl/septic-engineering/) for a property, but a qualified septic contractor must take into consideration four major factors before beginning the septic installation process: 1\. Soil Conditions – With septic engineering, the first thing a contractor will do is examine the soil conditions to make sure that the soil can handle wastewater disposal and that there aren’t any underlying factors that would prevent a septic system from being a good choice. 2\. Topography – The topography, or lay of the land, is also important in that homes or businesses that are constructed on a hilly area or with various landscaping features may require special designs for the most efficient septic system design. 3\. Buildings – Septic engineering must also take into consideration any current or future buildings that are on the site. Septic systems must not only accommodate any usage for new buildings, but also do not want to negatively affect surrounding buildings that also have wastewater management systems. 4\. Serviceability – Lastly, septic engineering must take into consideration the accessibility of the property. A contractor will want to make sure that in the event of a septic emergency, or even for routine services, they can easily access the different components of a home or business septic system. At Southern Water and Soil, we offer septic engineering services where [traditional septic systems](/septic-services-tampa-fl/septic-engineering/) may not always be a possibility. We would happy to answer your questions about this and provide any of your other septic servicing needs, so give us a call today. ### Related Posts: [## The Three P’s of Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/the-three-ps-of-septic-engineering/)[## We Are Equipped to Assist With Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/we-are-equipped-to-assist-with-septic-engineering/)[## Septic Engineering for Success and Ease of Maintenance](https://southernsepticanddesign.com/septic-services-blog/septic-engineering-for-success-and-ease-of-maintenance/) **Categories:** Septic Services Blog **Tags:** Septic Engineering --- ### [Why Do I Need a Septic Permit Application?](https://southernsepticanddesign.com/septic-services-blog/why-do-i-need-a-septic-permit-application/) **Published:** October 16, 2017 **Author:** Southern Water Soil **Content:** ![septic permit application](/wp-content/uploads/2017/08/iStock-612737296-300x200.jpg)At Southern Water and Soil, we often get questions about how a[ septic system ](/commercial-septic-tampa-fl/commercial-septic-permits/commercial-septic-permit-application/)is designed, what to expect from installation, and whether there is anything special that needs to be done before breaking ground. The one question that many people forget to ask, however, is about the required septic permit application. A septic permit application is a state and local requirement that gives you permission to [add a septic tank](/commercial-septic-tampa-fl/commercial-septic-permits/commercial-septic-permit-application/) to your property, and it also alerts the local authorities to the installation of an onsite wastewater system within a specific jurisdiction. Your local and state governments regulate the type of septic systems that can be installed, and they also want to maintain a healthy wastewater management system throughout each city and county. By getting a septic permit application approved, you’ll be able to tell your septic contractor that you can break ground on your new septic system, and your local authorities will most likely come to inspect the septic system to make sure that it meets governmental regulations. [You can find some information about how to get your septic permit application on the State of Florida’s page.](https://www.floridahealth.gov/environmental-health/onsite-sewage/ostds-permitting.html) At Southern Water and Soil, we help home and business owners complete the septic permit application process and we can work with you to ensure that your septic system is set up for success. We have over three decades of experience providing our customers with the septic services they need to achieve the best results from their property. Contact us today to learn more! ### Related Posts: [## How a Professional Completes a Septic Permit Application in 4 Easy Steps](https://southernsepticanddesign.com/septic-services-blog/how-a-professional-completes-a-septic-permit-application-in-4-easy-steps/) **Categories:** Septic Services Blog **Tags:** septic permit application --- ### [Is it Time to Replace Your Commercial Septic Drain Field?](https://southernsepticanddesign.com/septic-services-blog/is-it-time-to-replace-your-commercial-septic-drain-field/) **Published:** February 15, 2018 **Author:** Southern Water Soil **Content:** ![Commercial Septic Drain Field in Tampa, Florida](/wp-content/uploads/2018/02/iStock-694969494-resize.jpg) If your business operates on a septic system, you may already know the exactly location of your [commercial septic drain field](/septic-services-tampa-fl/septic-drain-field/commercial-septic-drain-field/). In fact, as you have your septic system serviced each year, your septic company may offer a quick inspection to make sure there aren’t any hidden problems with this important cohttps://southernsepticanddesign.commponent of your wastewater system. If your tank seems to be in good condition, then your drain field is probably in good shape, too. There may be indicators, however, that you need to replace your commercial septic drain field separate from maintenance or repairs to your septic tank. For example, if your commercial septic drain field is located in a place where water runoff is a problem, or you don’t have good drainage, your drain field could be suffering. Another indicator that commercial septic drain field replacement is a priority is if you have construction looming near the drain field site. You may wish to move or re-align your drain field to better accommodate your growing business facility, so that it is protected against construction damage. There are some other more common indicators that commercial septic drain field replacement is required, such as having pooling water at the site, strange odors coming from outside your facility, and damage caused by tree roots or heavy equipment. [Protecting your commercial business from the outside](/septic-services-tampa-fl/septic-drain-field/commercial-septic-drain-field/) in is an important part of maintaining your facility. At Southern Water and Soil, we can provide expert solutions when you require services related to your commercial septic drain field. Contact us today to schedule an estimate. ### Related Posts: [## What Should You Do About Commercial Septic Drain Field Failure?](https://southernsepticanddesign.com/septic-services-blog/what-should-you-do-about-commercial-septic-drain-field-failure/) **Categories:** Septic Services Blog **Tags:** Commercial Septic Drain Field --- ### [Achieving Longevity with Commercial Septic System Maintenance](https://southernsepticanddesign.com/septic-services-blog/achieving-longevity-with-commercial-septic-system-maintenance/) **Published:** March 15, 2018 **Author:** Southern Water Soil **Content:** ![Commercial Septic in Tampa, Florida](/wp-content/uploads/2018/03/iStock-853723494-resize.jpg) A commercial septic system is a cost-effective way to manage your wastewater treatment needs for businesses of just about any size. Whether you operate out of a home that has been repurposed for a commercial business, or you have a larger facility that produces goods and materials, the right septic system is an essential part of keeping your business healthy and efficient. This means that[ commercial septic system maintenance ](/commercial-septic-tampa-fl/)is crucial. But what exactly does commercial septic system maintenance mean for your business? Is it just routine septic tank cleaning like you would require at a residence? For the longevity of your wastewater system, commercial septic system maintenance is required and involves some careful planning. To start, your commercial septic system maintenance plan should include some of the basic steps you would find at a residence, like routine septic tank cleaning and an inspection. Where things begin to differ is in the timing and the care required to achieve the best cost-benefit from this important system. You should schedule routine commercial septic system maintenance at a minimum of once per year, depending upon your facility size and usage. The potential for more frequent maintenance comes with the age and condition of your septic tank and drain field, and that of your facility. While commercial septic systems are ideal for a variety of different businesses, maintenance is crucial for their long-term operation. You will find that you save money and that you avoid unexpected septic backups with routine commercial septic system maintenance, including repairing and replacing parts as needed. At Southern Water and Soil, we are equipped to [help with all aspects of your commercial septic system](/commercial-septic-tampa-fl/), from design to engineering and maintenance. Contact us today to schedule service. ### Related Posts: [## 3 Reasons You Need Commercial Septic System Maintenance Contracts](https://southernsepticanddesign.com/septic-services-blog/3-reasons-you-need-commercial-septic-system-maintenance-contracts/) **Categories:** Septic Services Blog **Tags:** Commercial Septic System Maintenance --- ### [Quick Design Elements That Will Save Your Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/quick-design-elements-that-will-save-your-septic-engineering/) **Published:** April 16, 2018 **Author:** Southern Water Soil **Content:** ![Septic Engineering in Brandon, Florida](/wp-content/uploads/2018/04/iStock-157586313-resized-300x200.jpg) When it comes to choosing the parts for a septic system and ensuring that they are laid out properly, there are a few design elements that are important. While it is the basic components that bring a septic system together, the design and [septic engineering](/septic-services-brandon-fl/septic-engineering/) are what truly create a working, stable septic system for any home or business. Here are a few design elements that will make septic engineering for any property more effective and efficient: - **Tank** – The septic tank often receives the most focus during any septic engineering project, and for good reason. It’s the first point of contact for wastewater beyond a home or business’ plumbing. Knowing the size and scope of the tank, and planning ahead for potential growth and usage, can save a lot of money and the potential for problems down the line. - **Lift Station** – A lift station is crucial when the lay of the land requires solutions for proper flow of wastewater. What can become problematic is a lift station that isn’t geared towards the type of wastewater system that is installed. Choosing wisely for both residential and commercial applications can promote the effectiveness of septic engineering. - **Alarm** – A septic alarm is often the first line of defense against a backup after the backwater valve has been activated. Having an alarm that is durable, can be set appropriately for the type of septic system, and offers users the ability to test and reset is an important aspect of septic engineering. - **Drain Field** – With the septic drain field, knowing the proper placement and the size required for the specific application is the best way to ensure longevity from a septic system. Using high-quality materials will also protect against damage and decay over time. At Southern Water and Soil, [we are well-versed in all types of septic engineering](/septic-services-brandon-fl/septic-engineering/) for homes and businesses. Contact us today to learn more about our services. ### Related Posts: [## The Three P’s of Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/the-three-ps-of-septic-engineering/)[## We Are Equipped to Assist With Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/we-are-equipped-to-assist-with-septic-engineering/)[## The Importance of Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/the-importance-of-septic-engineering/) **Categories:** Septic Services Blog **Tags:** Septic Engineering --- ### [Saying No: Why Commercial Real Estate Septic Inspections Are a Line of Defense](https://southernsepticanddesign.com/septic-services-blog/saying-no-why-commercial-real-estate-septic-inspections-are-a-line-of-defense/) **Published:** May 15, 2018 **Author:** Southern Water Soil **Content:** ![Real Estate Sale Septic Inspections in Land O’ Lakes, FL](/wp-content/uploads/2018/05/iStock-155394645-resize.jpg) When you are planning to expand your business, and would like to purchase a new facility, you may be considering the different properties that already exist. Not only is it practical to use existing infrastructure, but it could allow you to get your new operation going more quickly and efficiently. Before you make your purchase, however, you may want to schedule [commercial real estate septic inspections](/septic-services-land-olakes-fl/real-estate-sale-septic-inspections/) at all of the properties at the top of your list. That way you’ll know when to say yes, and when to say no. Commercial real estate septic inspections offer much more than just a precursory glance at a commercial septic system. Sure, they can be used to identify the type of system that is in place and the age and condition – but they can be so much more than that. For example, commercial real estate septic inspections should tell you whether you need to repair or replace any of the septic components prior to your being able to begin operations. Although this may seem like a small thing, in reality it can create unexpected costs as you apply for the proper commercial septic permits and schedule new installation. Even more importantly, commercial real estate inspections are a line of defense against seemingly up-to-date properties. Even if a prior company has taken time to update the interior of a facility, what is laying underneath can speak volumes about the care the facility has actually received. In this regard, you’ll know right away whether you’ll have more work to do than you intended before your real estate transaction takes place. At Southern Water and Soil, we offer commercial real estate septic inspections that [provide comprehensive information about a property](/septic-services-brandon-fl/real-estate-sale-septic/buying-a-home-with-a-septic-system/). If you are interested in expanding your business, give us a call today to schedule an appointment. ### Related Posts: [## Planning to Buy? Commercial Real Estate Septic Inspections are Critical](https://southernsepticanddesign.com/septic-services-blog/planning-to-buy-commercial-real-estate-septic-inspections-are-critical/)[## Steps to Take After Receiving Commercial Real Estate Septic Inspection Results](https://southernsepticanddesign.com/septic-services-blog/steps-to-take-after-receiving-commercial-real-estate-septic-inspection-results/) **Categories:** Septic Services Blog **Tags:** Commercial Real Estate Septic Inspections --- ### [Are Septic System Warranty Packages a Worthwhile Investment?](https://southernsepticanddesign.com/septic-services-blog/are-septic-system-warranty-packages-a-worthwhile-investment/) **Published:** June 15, 2018 **Author:** Southern Water Soil **Content:** ![Septic System Warranty Packages in Tampa, Florida](/wp-content/uploads/2018/06/iStock-893989572-resized-272x300.jpg) If you have called us at Southern Water and Soil for a septic system installation, repair, or replacement, then you may be wondering whether choosing one of our septic system warranty packages is a worthwhile investment. After all, your septic system is designed to last for many years, so once any problems are resolved, there isn’t much that could go wrong. While we always like to believe that our quality workmanship speaks for itself, there are times when our [septic system warranty packages](/septic-systems-tampa-fl/septic-system-warranty-packages/) are worth it. For example, if another company installed your septic system, you may find that you need additional repairs or replacement parts to other components, even after our work is done. In cases such as these, having a warranty can serve you well. Septic system warranty packages are meant to act as an added layer of protection against the things you didn’t know could be a problem. If a faulty filter is installed, a septic alarm malfunctions, or some other problem occurs causing a septic situation, having septic system warranty packages can make all the difference in your peace of mind and in the money you spend. We offer septic system warranty packages for our customers because we want you to know how much your business means to us, and that your [complete trust is important to us](/septic-systems-tampa-fl/septic-system-warranty-packages/). We’ll work with you to ensure that you have only the best septic services available to you at every turn. Contact us at Southern Water and Soil today if you require septic solutions for your home or business, and let’s discuss the septic system warranty packages that are right for you. **Categories:** Septic Services Blog **Tags:** Septic System Warranty Packages --- ### [Commercial Septic Permits: Things You Should Know](https://southernsepticanddesign.com/septic-services-blog/commercial-septic-permits-things-you-should-know/) **Published:** July 16, 2018 **Author:** Southern Water Soil **Content:** ![Commercial Septic](/wp-content/uploads/2018/06/iStock-522437683_res.jpg) If you’re planning a new commercial septic installation, you’ll want to make sure you have the proper permitting in place. Whether you are a new business owner or have been operating commercial businesses for a while, you may find yourself juggling many tasks when it comes to the construction of your commercial septic system. One of the many things that you’ll want to prioritize is your commercial septic permit, which will be the thing that allows you to establish a wastewater treatment plant on your property. With [commercial septic permits](/commercial-septic-lutz-fl/), you may be surprised to learn that while your septic company can assist you with this process, they cannot actually earn the right to build on their own. They will provide you with the required documentation and information you need, but ultimately, you’ll be responsible for getting the proper permitting from the city or county in which your business is situated. Additionally, you’ll want to plan well in advance for your commercial septic permit so that your site development and installation goes as planned. There has been many a hold up with commercial septic installation because of a wait on the proper permit that wasn’t planned for accordingly. With some careful attention to detail, you can avoid the pitfalls that come with missing deadlines for a commercial septic permit. At Southern Water and Soil, we are your top septic company for [commercial septic](/commercial-septic-lutz-fl/) installation and we can walk you through the necessary steps to achieve permitting for septic installation at your business. If you have questions or need to talk with a commercial septic specialist, give us a call today. ### Related Posts: [## What You Should Know About Septic Tank Standards in Commercial Septic Applications](https://southernsepticanddesign.com/septic-services-blog/what-you-should-know-about-septic-tank-standards-in-commercial-septic-applications/)[## Dos and Don’ts of a Commercial Septic System](https://southernsepticanddesign.com/septic-services-blog/dos-and-donts-of-a-commercial-septic-system/) **Categories:** Septic Services Blog **Tags:** Commercial Septic --- ### [The Three P’s of Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/the-three-ps-of-septic-engineering/) **Published:** August 15, 2018 **Author:** Southern Water Soil **Content:** ![Septic Engineering](/wp-content/uploads/2018/06/iStock-467926711_res.jpg) When it’s time to install a new septic system at your commercial business, whether you are breaking ground or installing a replacement system, there are a few rules of thumb that will ensure the success of your new [wastewater treatment solution](/septic-services-lutz-fl/septic-engineering/). These three “P’s” help explain: 1\. **Planning** –You’ll need an expert plan of action with accurate septic engineering. Not only do you need to address any problems an old system may have given you, but you’ll want to make sure that your septic engineer uses the best layout of the land for your new commercial septic system. 2\. **Permitting** – Secondly, without the proper permitting, you may find yourself waiting to establish your new commercial septic system. You’ll need to work with your city and county officials to attain proper permitting before any of your [septic engineering](/septic-services-lutz-fl/septic-engineering/) plans can come to fruition. Your septic company can help you plan to get your permits so that you can proceed with installation on schedule. 3\. **Implementation** – Finally, your commercial septic company can implement your new commercial septic system so that you have an efficient and effective wastewater management solution. Fortunately, if the first two P’s are done correctly, this part will be completed quickly and allow you to continue your other plans for business development or improvements. At Southern Water and Soil, we know how important septic engineering is, but we can’t implement without planning and permitting first. Luckily, we are knowledgeable about every aspect of commercial septic installation and will work with you to achieve the best results. [Contact us](/contact-southern-water-and-soil/) today to learn more. ### Related Posts: [## Quick Design Elements That Will Save Your Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/quick-design-elements-that-will-save-your-septic-engineering/)[## The Importance of Septic Engineering](https://southernsepticanddesign.com/septic-services-blog/the-importance-of-septic-engineering/)[## Septic Engineering for Success and Ease of Maintenance](https://southernsepticanddesign.com/septic-services-blog/septic-engineering-for-success-and-ease-of-maintenance/) **Categories:** Septic Services Blog **Tags:** Septic Engineering --- ### [Planning to Buy? Commercial Real Estate Septic Inspections are Critical](https://southernsepticanddesign.com/septic-services-blog/planning-to-buy-commercial-real-estate-septic-inspections-are-critical/) **Published:** September 14, 2018 **Author:** Southern Water Soil **Content:** ![Commercial Real Estate Septic Inspections](/wp-content/uploads/2018/06/iStock-956817890_res.jpg) If you plan to purchase any business that utilizes a septic system for wastewater management, you’ll want to be sure that you choose to have a commercial real estate septic inspection before making any decisions. Why? [Commercial real estate septic inspections](/commercial-septic-lutz-fl/) are the only way to determine what you are actually dealing with at a business location. Here are some great reasons to schedule this service: - **Find the Flaws** – When purchasing any type of commercial business, you can’t always know how well the septic system was maintained by the previous owner. Commercial real estate septic inspections ensure that you find any existing flaws that should be addressed before you spend money on a new location. - **Know the Situation** – Another important element of commercial septic inspections is that you’ll have a better idea of what you’re dealing with upon a commercial business purchase. For example, an inspection may show that the septic system is in great condition, or it may determine that there is much to be done to restore this important [wastewater management system](/commercial-septic-lutz-fl/). - **Determine Next Steps** – Once you have a commercial real estate septic inspection completed at one or more of the business locations you are considering, you will then know how to proceed with your purchase. It also gives you negotiating power should you decide that something needs work prior to completing any contracts. At Southern Water and Soil, we have seen how commercial real estate inspections can affect a business purchase with positive and negative outcomes. We also have extensive experience providing this service for our commercial clients. [Contact us](/contact-southern-water-and-soil/) today to schedule an appointment. ### Related Posts: [## Steps to Take After Receiving Commercial Real Estate Septic Inspection Results](https://southernsepticanddesign.com/septic-services-blog/steps-to-take-after-receiving-commercial-real-estate-septic-inspection-results/)[## Saying No: Why Commercial Real Estate Septic Inspections Are a Line of Defense](https://southernsepticanddesign.com/septic-services-blog/saying-no-why-commercial-real-estate-septic-inspections-are-a-line-of-defense/) **Categories:** Septic Services Blog **Tags:** Commercial Real Estate Septic Inspections --- ### [What Should You Do About Commercial Septic Drain Field Failure?](https://southernsepticanddesign.com/septic-services-blog/what-should-you-do-about-commercial-septic-drain-field-failure/) **Published:** October 15, 2018 **Author:** Southern Water Soil **Content:** ![Commercial Septic Drain Field](/wp-content/uploads/2018/06/iStock-872001496_res.jpg) Let’s hope this is a question you never have to ask yourself because the implications are pretty harsh. [Commercial septic drain field](/septic-services-lutz-fl/septic-drain-field/drain-field-design/) failure not only means that your property is at risk, but it could potentially shut your business down for days or weeks while the problem is resolved. Of course, the best answer is to address any concerns early on, but what should you do should your commercial septic drain field truly fail? Here are some important steps: 1\. **Stop Operations Immediately** – Because all your waste is processed through your septic system, you’ll want to stop operations immediately when you notice a septic drain field failure. It may take several minutes to cease septic waste from traveling through your system and you’ll need to act quickly to stop further damage. 2\. **Contact Your Local Authorities** – One of the hardest phone calls you might have to make is to your local authorities, but they will need to be onsite to manage any after effects of a drain field failure at your business. They will also be the ones to provide permitting and approval for [drain field repair and replacement](/septic-services-lutz-fl/septic-drain-field/drain-field-installation/). 3\. **Contact Your Commercial Septic Company** – The next call should be to a commercial septic company that is well-versed when it comes to commercial septic systems. That’s where our team at Southern Water and Soil comes in. We are knowledgeable about the many types of commercial septic drain fields that are on the market, old and new, and we’ll make sure to provide expert services that get your business up and running again as quickly as possible. Another important step will be to have emergency procedures in place for your employees to follow should any type of commercial septic situation arise. This way, you can protect the health and wellbeing of all involved. [Reach out to us](/contact-southern-water-and-soil/) at Southern Water and Soil for the commercial septic services you require. ### Related Posts: [## Is it Time to Replace Your Commercial Septic Drain Field?](https://southernsepticanddesign.com/septic-services-blog/is-it-time-to-replace-your-commercial-septic-drain-field/) **Categories:** Septic Services Blog **Tags:** Commercial Septic Drain Field --- ### [Repair or Replace? What to Do When You Need Septic Tank Repairs](https://southernsepticanddesign.com/septic-services-blog/repair-or-replace-what-to-do-when-you-need-septic-tank-repairs/) **Published:** December 14, 2018 **Author:** Southern Water Soil **Content:** ![Repair or Replace? What to Do When You Need Septic Tank Repairs](/wp-content/uploads/2018/12/2012-11-13-14.33.58_res.jpg) Owning [a septic system can be a great way to efficiently filter out your wastewater](/septic-services-brandon-fl/). It is often more efficient to run a septic system than it is to be hooked up to a city sewer! However, when you have your own mini wastewater treatment plant in the form of a septic system, you also need to keep up on maintenance and repairs. Here at Southern Water and Soil, we have come up with a few helpful tips for you to decide if your tank needs replacement or repairs. **Septic Tank Replacement** - If your septic tank is continually being overwhelmed by the capacity of your family, you might consider replacement. Not all septic tanks are created equal and there are times when a property is bought with a too-small tank. - If you are calling for septic tank repairs more than 2-3 times per year, consider replacement. An aging septic tank can be as fickle as an old car, and cost just as much in repairs over time than replacement. If you’re making frequent repairs every year, it might be time to replace it altogether. - If another part of your system has failed, you might want to use the opportunity to replace your tank as well. **Septic Tank Repairs** - If your tank is in relatively good shape but there were problems with other parts of the system, the septic tank can be repaired or reused. - If repairs are an infrequent occurrence on your property, going with repairs is the way to go. If you are [looking for qualified septic tank repairs, please contact our experts](/septic-services-brandon-fl/) at Southern Water and Soil for assistance. **Categories:** Septic Services Blog **Tags:** Septic Tank Repair --- ### [How to Add Some Flexibility into Your Drain Field Design](https://southernsepticanddesign.com/septic-services-blog/how-to-add-some-flexibility-into-your-drain-field-design/) **Published:** January 15, 2019 **Author:** Southern Water Soil **Content:** ![How to Add Some Flexibility into Your Drain Field Design](/wp-content/uploads/2018/12/2013-09-11-14.09.20_res.jpg) When it comes to your septic system, there’s really not many things you can do in terms of customization and flexibility. While you can work with different grades of land and different sizes of tanks, beyond that, it’s important for you to keep your septic system running well and maintained in order for it to function properly. [The drain field, on the other hand, can offer a little more flexibility](/commercial-septic-drain-field/drain-field-design/). Ideally, a drain field is located under a large expanse of land without structures, trees, or other items on top of it. If you don’t have that kind of space on your property however, you need your drain field design to be a little bit more flexible. Here are some [ideas for drain field design](/commercial-septic-drain-field/drain-field-design/) that you can discuss with your septic experts to determine if they will work for you. A drip irrigation system is very similar to a drain field in that a series of tubes will allow cleaned wastewater to percolate back into the groundwater. However, drip irrigation systems are much smaller and thinner types of tubing that are buried at a much shallower depth. Because this tubing is flexible, it is much easier to work around existing structures, trees or shrubs. This type of drain field design needs to be completed by experienced professionals like ours at Southern Water and Soil. Because drip irrigation needs extra help draining the water, additional items might need to be added to your septic system. For questions about drain field design and how to make yours fit your property, give us a call today. ### Related Posts: [## What’s Involved in a Drain Field Design?](https://southernsepticanddesign.com/septic-services-blog/whats-involved-in-a-drain-field-design/)[## Three Important Considerations for Drain Field Design](https://southernsepticanddesign.com/septic-services-blog/three-important-considerations-for-drain-field-design/) **Categories:** Septic Services Blog **Tags:** Drain Field Design --- ### [Steps to Take After Receiving Commercial Real Estate Septic Inspection Results](https://southernsepticanddesign.com/septic-services-blog/steps-to-take-after-receiving-commercial-real-estate-septic-inspection-results/) **Published:** February 15, 2019 **Author:** Southern Water Soil **Content:** ![Steps to Take After Receiving Commercial Real Estate Septic Inspection Results](/wp-content/uploads/2018/12/2012-01-26-13.34.57_rees.jpg) The process of buying commercial real estate can be a nerve-wracking one. Even if you have gone through the process before, commercial real estate is entangled with many different laws, requirements and loopholes that you won’t find in residential real estate. If you are in the process of buying a commercial real estate property and have just received your commercial real estate septic inspection results, you might worry about how to proceed. Here are a few things you can do to determine if this property is right for you. You’ll need to determine the current state of the septic system from your [commercial real estate septic inspection](/septic-services-brandon-fl/). A septic inspection can give you information about the age of the system, the current functionality, if and what repairs are in the future, and if the tank is the right capacity for the potential commercial property. Minor repairs can be dealt with and even negotiated into a contract, but major repairs might signal that you need to look at other properties. After thoroughly reviewing the commercial real estate septic inspection, you’ll need to determine if you want to move forward with the property. You can decide if repairs need to be made before the sale of the property by a company of your choosing, the seller’s choosing, or if the seller will pay for any repairs after the purchase of the property. If you need help assessing or determining what to do in the case of commercial real estate septic inspections, our team here at Southern Water and Soil can help. With over 30 years of experience, [we can not only perform the inspection, but give you advice on how to proceed.](/septic-services-brandon-fl/) Contact us today with any questions you might have. ### Related Posts: [## Planning to Buy? Commercial Real Estate Septic Inspections are Critical](https://southernsepticanddesign.com/septic-services-blog/planning-to-buy-commercial-real-estate-septic-inspections-are-critical/)[## Saying No: Why Commercial Real Estate Septic Inspections Are a Line of Defense](https://southernsepticanddesign.com/septic-services-blog/saying-no-why-commercial-real-estate-septic-inspections-are-a-line-of-defense/) **Categories:** Septic Services Blog **Tags:** Commercial Real Estate Septic Inspections --- ### [3 Reasons You Need Commercial Septic System Maintenance Contracts](https://southernsepticanddesign.com/septic-services-blog/3-reasons-you-need-commercial-septic-system-maintenance-contracts/) **Published:** March 15, 2019 **Author:** Southern Water Soil **Content:** ![3 Reasons You Need Commercial Septic System Maintenance Contracts](/wp-content/uploads/2018/12/2011-11-29-15.19.35_res-179x300.jpg) Owning a commercial property can be a great benefit for a business or rental possibility. However, if you are the owner of a commercial property outside the reach of a sewer system, then you’ll need a commercial septic system to clean and discharge wastewater that exits the building. There are many septic companies available out there, but here are three reasons why you need to seek out one that offers commercial septic system maintenance contracts. 1. **Reliability**. When you enter into a [commercial septic system maintenance contract](/commercial-septic-brandon/) with a septic company, you are giving yourself a reliable option for your septic needs. 2. **Scheduling.** Having a commercial septic system maintenance contract is the ultimate in scheduling convenience. Because most of these maintenance checks are done on a set schedule, you can work the times around when is most convenient for you, not the other way around. 3. **Preventative Care.** Commercial septic system maintenance contracts guarantee that you complete the necessary preventative care that is recommended for your commercial septic system. Many people simply forget or postpone their commercial septic system maintenance appointments until it’s too late and a real problem presents itself. With commercial septic system maintenance contracts, however, [preventative care of your septic system will be regular and ](/commercial-septic-brandon/)cost efficient. For information about the commercial septic system maintenance contracts that we offer here at Southern Water and Soil, please give us a call today. We would love to discuss your commercial septic system maintenance needs with you. ### Related Posts: [## Achieving Longevity with Commercial Septic System Maintenance](https://southernsepticanddesign.com/septic-services-blog/achieving-longevity-with-commercial-septic-system-maintenance/) **Categories:** Septic Services Blog **Tags:** Commercial Septic System Maintenance --- ### [Get the Right System When You Choose the Right Commercial Septic System Design](https://southernsepticanddesign.com/septic-services-blog/get-the-right-system-when-you-choose-the-right-commercial-septic-system-design/) **Published:** April 15, 2019 **Author:** Southern Water Soil **Content:** ![Get the Right System When You Choose the Right Commercial Septic System Design](/wp-content/uploads/2018/12/2014-01-11-00.12.54_res-300x300.jpg) When you have a commercial property, you are responsible not just for the building, but for the utilities and other needs concerning your commercial property! Whether you are in the process of building a property or upgrading the septic system of an existing property, choosing the right [commercial septic system design](/commercial-septic-tampa-fl/commercial-septic-system-design/) is crucial to maintain the effectiveness of your septic system. When looking at commercial septic system designs, make sure that you choose a septic contractor with an actual engineer on staff. A qualified engineer can ensure that your septic system is able to work in and around the property that you have without hassle. This means that you will need to have an engineer adjust for issues such as space, existing structures, the grade and level of the land, and other important components in your commercial septic system design. A few things that your engineer might want to look at adding to your commercial septic system design are pumps, aerators, and drip lines. An aerator can ensure a fresh supply of oxygen to keep the good bacteria in your septic tank happy. Additionally, with the circulating air, the ability of the bacteria to break down the solid waste can actually be accelerated. Pumps can help wastewater be pumped through the system instead of relying on gravity and can help water drain efficiently through drip lines. If you are looking for a new or improved commercial septic system design, [let our qualified engineers here at Southern Water and Soil assist you](/commercial-septic-tampa-fl/commercial-septic-system-design/). ### Related Posts: [## Does Your Commercial Septic System Design Meet Your Requirements?](https://southernsepticanddesign.com/septic-services-blog/does-your-commercial-septic-system-design-meet-your-requirements/)[## 3 Factors that Can Affect Your Commercial Septic System Design](https://southernsepticanddesign.com/septic-services-blog/3-factors-that-can-affect-your-commercial-septic-system-design/) **Categories:** Septic Services Blog **Tags:** Commercial Septic System Design --- ### [What Creates the Need for Package Plant Installations?](https://southernsepticanddesign.com/septic-services-blog/what-creates-the-need-for-package-plant-installations/) **Published:** May 15, 2019 **Author:** Southern Water Soil **Content:** ![you will need to become familiar with package plant installations](/wp-content/uploads/2019/04/iStock-962256274_resize.jpg) Starting up a business in an area where there aren’t municipal services, such as sewer lines, has the added challenge of designing a specialized system. While a small business may not need much more in terms of a septic system than a large home, others have advanced needs. If you will need to process thousands or even millions of gallons of wastewater a day,[ you will need to become familiar with package plant installations](/package-plant-installations-tampa-fl/). These systems must be designed by an experienced professional as they can include a series of components, and the right types must be selected based on a variety of factors, including your business operations, location, and more. For example, your business might do well with a series of tanks. A community project might choose a cluster wastewater treatment system or effluent sewer system. To determine the best package plant installations, you also need to look at effluent parameters. Whether your business or community needs to deal with coliform levels, suspended solids, chlorine residuals, or some other specific effluent situation, these are all things that need to be considered. These questions and other factors dictate which components will be needed, such as an activated sludge aeration, trash trap, lift station, rapid sand filtration, froth control, grease interceptor, oil separator, and more. Here at Southern Water and Soil, our group of professionals has years of experience with [package plant installations](/package-plant-installations-tampa-fl/). We are equipped to handle complex situations, including successfully navigating the permitting process. Contact us today to discuss your upcoming project or to handle maintenance or repair of an existing commercial septic system. ### Related Posts: [## The Advantages of Package Plant Installations](https://southernsepticanddesign.com/septic-services-blog/the-advantages-of-package-plant-installations/) **Categories:** Septic Services Blog **Tags:** Package Plant Installations --- ### [What You Should Know About Septic Tank Standards in Commercial Septic Applications](https://southernsepticanddesign.com/septic-services-blog/what-you-should-know-about-septic-tank-standards-in-commercial-septic-applications/) **Published:** June 14, 2019 **Author:** Southern Water Soil **Content:** ![When you work with us at Southern Water and Soil for your commercial septic installation](/wp-content/uploads/2019/04/iStock-467928873_resize.jpg) If you are having a new [commercial septic](/commercial-septic-tampa-fl/) tank installed for either new construction or to replace a failed tank, you should know that there is more involved than just choosing the right system and size for your needs. The actual quality of the septic tank matters if you want reliable, long-lasting performance. While a lot of emphasis is put on meeting permitting standards and properly maintaining the septic tank, how well-built it is could be even more important. It might surprise you that although regulations will dictate that septic tanks must be structurally sound and watertight, when the inspectors put their stamp of approval on one, they often have not checked to see if the septic tank meets the standards you would want. All too often, a substandard septic tank is found to be the cause for premature failure. It may have thin walls or very little, if any, steel reinforcement. While this might work out for a residential situation where the soils are sufficient to provide the needed support, it is a recipe for disaster with commercial septic applications. It may be tempting to go with the lowest bid, but you’ll do yourself a disservice if you don’t work with a professional that will carefully engineer your commercial septic system to strong ASTM standards. When you work with us at Southern Water and Soil for your commercial septic installation, you get the benefit of our years of experience and our dedication to quality. We will always provide you with pertinent information about the options involved so that you can get results you feel good about. We want you to have peace of mind that you won’t be dealing with a failed system in just a few years, resulting in more costs than you would have experienced with a quality system to begin with. [Contact us today to learn more about our commercial septic services](/commercial-septic-tampa-fl/). ### Related Posts: [## Dos and Don’ts of a Commercial Septic System](https://southernsepticanddesign.com/septic-services-blog/dos-and-donts-of-a-commercial-septic-system/)[## Commercial Septic Permits: Things You Should Know](https://southernsepticanddesign.com/septic-services-blog/commercial-septic-permits-things-you-should-know/) **Categories:** Septic Services Blog **Tags:** Commercial Septic --- ### [Taking Your Septic to the Next Level with Aerobic Septic Systems](https://southernsepticanddesign.com/septic-services-blog/taking-your-septic-to-the-next-level-with-aerobic-septic-systems/) **Published:** July 15, 2019 **Author:** Southern Water Soil **Content:** ![There are various types of aerobic septic systems](/wp-content/uploads/2019/04/iStock-498831078_resize.jpg) The great thing about technological advances is that they give you more choices. You can save money by going with an older model or go all in and pay for all the bells and whistles you want. If you are more likely to purchase the car model with heated seats and other upgrades than the base model with crank windows, you might want to know more about how you can take your commercial septic to the next level as well. While some advanced treatment systems are necessary because of your specific situation, others are an option if you want to increase performance. Aerobic septic systems are a common choice when you want to achieve a more efficient breakdown and digestion of organic solids and reduce pathogens in the effluent. These systems incorporate air to accomplish this task, which is quite different from a traditional anaerobic system that has no oxygen involved. There are various types of aerobic septic systems, including [suspended-growth, fixed-film, and sequencing batch reactors](/commercial-septic-tampa-fl/). Each has its own benefits and related costs. An experienced septic contractor that installs aerobic septic systems can discuss which they recommend for your situation based on a variety of factors, including budget, location, usage, and objectives. Not all systems are approved for every area either. Here at Southern Water and Soil, we are quite familiar with the permitting process involved with [aerobic septic systems](/commercial-septic-tampa-fl/) and we are experienced with designing, installing, and maintaining this advanced type of septic treatment system. We are happy to assess your situation and provide relevant information so that you can decide if taking your septic system to the next level makes sense for your situation. Contact us today to learn more. ### Related Posts: [## Why Aerobic Septic Systems “Work Out”](https://southernsepticanddesign.com/septic-services-blog/why-aerobic-septic-systems-work-out/) **Categories:** Septic Services Blog **Tags:** aerobic septic systems --- ### [Why Septic System Design is Important to Get Right](https://southernsepticanddesign.com/septic-services-blog/why-septic-system-design-is-important-to-get-right/) **Published:** August 15, 2019 **Author:** Southern Water Soil **Content:** It might not seem like there is much involved with [septic system design](/commercial-septic-tampa-fl/), but the reality is that if it isn’t done right, the outcome can be far from pleasurable. When it isn’t done right, there is a good chance the system will fail prematurely, be a health hazard, or need costly repairs, all while creating a real mess inside your home or business. To better understand why septic system design is important to get right, consider these typical causes of septic system failure: - The septic tank is too small for the amount of wastewater introduced to it. This is a common septic system design failure when a company looks only to what the minimum amount is needed for permitting and doesn’t take into consideration how the family or business will actually be utilizing the septic system. ![developing the right septic system design for the application at hand](/wp-content/uploads/2019/04/iStock-912867216_resize.jpg) - The septic tank wasn’t built to be structurally sound and watertight. It is important not to put too much faith in the soils surrounding the tank to provide support. A substandard tank may save upfront costs, but it will likely cause you problems down the road. - The septic system wasn’t properly maintained. Be sure the company that provides the septic system design and installation thoroughly explains the maintenance needed to keep your system performing as it should. - Introducing the wrong things into the septic system. It is important to discuss everything about your business operations when the septic system design is being drafted, including any unusual items you need the septic system to handle. Also be sure to learn what you can and cannot introduce to the system. - Poor septic system design that doesn’t allow proper flow of wastewater through the system. Any number of things can go wrong if not properly addressed during the design stage, including how to deal with inadequate drain field soils, installing the right size of drain field, and adding any components needed for your type of business. At Southern Water and Soil, our engineers are exceptional at [developing the right septic system design for the application at hand](/commercial-septic-tampa-fl/). They don’t cut corners trying to get your project done faster than is feasible that would result in lower quality and problems down the road. We’ll keep you in the loop throughout the process so that you provide vital input and know what to expect both during the process and after your completed septic system design. Contact us today to learn more about our commercial septic services. ### Related Posts: [## The Right Septic System Design Can Make All the Difference for Your Home or Business](https://southernsepticanddesign.com/septic-services-blog/the-right-septic-system-design-can-make-all-the-difference-for-your-home-or-business/)[## Septic System Design and Your Property](https://southernsepticanddesign.com/septic-services-blog/septic-system-design-and-your-property/)[## Engineered Septic System Design in Florida](https://southernsepticanddesign.com/septic-services-blog/engineered-septic-system-design-in-florida/) **Categories:** Septic Services Blog **Tags:** septic system design --- ### [Dos and Don’ts of a Commercial Septic System](https://southernsepticanddesign.com/septic-services-blog/dos-and-donts-of-a-commercial-septic-system/) **Published:** September 16, 2019 **Author:** Southern Water Soil **Content:** ![Having a commercial septic system designed and installed ](/wp-content/uploads/2019/04/iStock-984688968_resize.jpg) [Having a commercial septic system designed and installed](/commercial-septic-tampa-fl/) is quite an investment and not one you want to repeat any time soon. Many of the dos and don’ts of commercial septic are similar to what you’d consider for your residential system, but there are a few other things you need to know if you’ve just started or purchased a commercial property that has a septic system. **Commercial Septic Dos:** - Do know what kind of commercial septic system you have. Take the time to discuss the system with the company that installed it for you, or if you are a new owner of an existing system, contact one to come out and assess the system and discuss the type and how to care for it. - Do have a diagram of your system to have handy when service is needed. You’ll save the maintenance team valuable time when you can tell them exactly where the components are, and this can save you on labor charges when service or repairs are needed. - Do keep good records about inspections, pumping, and other services. It will be helpful to ascertain a chronic problem so that steps can be taken to resolve them. - Do call for help the moment you notice an issue. Delays can turn small issues into costlier ones! - Do maintain healthy grass over the drain field to avoid erosion while avoiding landscaping with deep roots. **Commercial Septic Don’ts:** - Do not introduce things to the commercial septic system it is not equipped to handle. If in doubt about something, put it in the garbage or compost it instead. - Do not drive over, park, or construct anything near the commercial septic system. The added weight can damage the components, or you could make it impossible to service the system properly. - Do not dig near the septic system components as you risk damaging them. - Do not introduce toxins, such as paints, solvents, pesticides, chemicals or antibacterial products to the septic tank as these kill the natural microbes that treat the wastewater. - Don’t hesitate to ask your professional commercial septic contractor for tips, advice, and recommendations for the care and improvement of your system. Here at Southern Water and Soil, we are always happy to assist you with any of your [commercial septic](/commercial-septic-tampa-fl/) needs, and that includes providing professional advice and recommendations. We are also available to design new or replacement systems, discuss aerobic septic systems, and provide maintenance and repair services. We are equipped to handle all types of systems, including doing package plant installations. Contact us today to learn more. ### Related Posts: [## Commercial Septic Permits: Things You Should Know](https://southernsepticanddesign.com/septic-services-blog/commercial-septic-permits-things-you-should-know/)[## What You Should Know About Septic Tank Standards in Commercial Septic Applications](https://southernsepticanddesign.com/septic-services-blog/what-you-should-know-about-septic-tank-standards-in-commercial-septic-applications/) **Categories:** Septic Services Blog **Tags:** Commercial Septic --- ### [How to Find the Right Company for Your Residential Septic System Design](https://southernsepticanddesign.com/septic-services-blog/how-to-find-the-right-company-for-your-residential-septic-system-design/) **Published:** October 15, 2019 **Author:** Southern Water Soil **Content:** ![excellent workmanship and service to perform your residential septic system design](/wp-content/uploads/2019/09/2013-07-10-14.34.41-res.jpg) Selecting a good company for your [residential septic system design is an important decision](/septic-services-tampa-fl/septic-engineering/). A septic system is an investment. Here are a few priorities to look for to make sure you are left with no regrets: - **Knowledge and Experience**– Giving the job to someone without experience may end up costing you greatly. At Southern Water and Soil, we have over 30 years of combined experience with backgrounds in the Department of Health, the Department of Environmental Protection, and the Southwest Florida Water Management District. - **Proper liability insurance**-Ensuring proper insurance is in place protects you from liability if any company employees are injured on your property. - **Engineers**– Choosing a company with experienced engineers ensures that your residential septic system design will be specifically tailored to your needs. - **Septic tank contractors**– A contractor will make sure that everything is done according to code, meeting all the local requirements, so the installation is performed efficiently and correctly. - **Service**– Whether you are new to septic systems or not, you want someone who will keep you informed and allow you choices in the process. At Southern Water and Soil, we strive to keep our customers educated and included during each part of the septic system design process. If you want an experienced company with excellent workmanship and service to perform your [residential septic system design](/septic-services-tampa-fl/septic-engineering/), then you want our team at Southern Water and Soil. Give us a call today! **Categories:** Septic Services Blog **Tags:** Residential Septic System Design --- ### [Drain Field Options for Your Commercial Septic Drain Field](https://southernsepticanddesign.com/septic-services-blog/drain-field-options-for-your-commercial-septic-drain-field/) **Published:** November 15, 2019 **Author:** Southern Water Soil **Content:** ![find the most cost-effective and environmentally safe solutions as you consider your drain field options](/wp-content/uploads/2019/09/2012-01-26-14.54.33-feat.jpg) Are you currently considering options for your commercial septic drain field? Your decision should be based mostly on two factors. The first thing to consider when you are looking at [drain field options](/commercial-septic-drain-field-tampa-fl/drain-field-options/) is size. The size of your drain field is based largely on the type of industry it will serve and the average wastewater consumption that will occur. To help us estimate this usage, we typically categorize industries into three types of businesses: 1. Commercial (restaurants, shopping centers, hotels, etc.) 2. Institutional (hospitals, office buildings, schools, etc.) 3. Recreational (theaters, gyms, etc.) Once we have determined an adequate size for your commercial septic drain field, it will help you decide what type of system you want. The most common choice is a traditional drain field with soil over top of conventional gravel filtering. However, at Southern Water and Soil, we also offer [alternative drain field options](/commercial-septic-drain-field-tampa-fl/drain-field-options/): - Gravelless Systems-these are cost effective, easy to maintain, and easy on soil - Chamber Systems-these systems are easy to install and as a result do little damage to your landscaping At Southern Water and Soil, we strive to educate our customers. We have a highly experienced team that will guide you through any decisions that need to be made. We are committed to protecting Florida’s waters and will help you find the most cost-effective and environmentally safe solutions as you consider your drain field options. Call us today to schedule a consultation with one of our team members. ### Related Posts: [## Alternative Drain Field Options](https://southernsepticanddesign.com/septic-services-blog/alternative-drain-field-options/) **Categories:** Septic Services Blog **Tags:** Drain Field Options --- ### [Buying a New Property for Your Business? Don’t Forget About Septic System Inspections](https://southernsepticanddesign.com/septic-services-blog/buying-a-new-property-for-your-business-dont-forget-about-septic-system-inspections/) **Published:** December 16, 2019 **Author:** Southern Water Soil **Content:** ![choose an inspector for your septic system inspections](/wp-content/uploads/2019/09/2012-01-26-13.35.42-res.jpg) When you are buying a new space for your business, you will be doing yourself a service by getting a septic system inspection. [Septic system inspections can help save you money](/septic-services-lutz-fl/) or give you the warning you need before buying a failing system, which can be very expensive to repair. It is in your best interest to obtain this inspection yourself as the buyer, as it will ensure the information you are given is not compromised. To help you choose an inspector for your septic system inspections, you will want to check their experience and credentials. At Southern Water and Soil, we have worked hard to earn our reputation as a trusted, premier commercial septic company. With 30 years in the industry and all the necessary education and licensing, we our equipped to perform your inspection with excellence. We can provide you with both the information and documentation you need, as well as the ability to provide any services needed to get the system in excellent working order. There are two basic types of commercial septic system inspections: Standard inspections and comprehensive inspections. 1. **Standard inspections**– These are sufficient for most conventional systems, drywells, and non-pressurized pump dispersal systems. 2. **Comprehensive inspections**-These are needed for aerobic treatment units, low pressure dosing systems, alternative sewage systems and older conventional septic systems. When you are in need of commercial [septic system inspections](/septic-services-lutz-fl/), come to us at Southern Water and Soil. Our cross-trained, highly experienced team will be there to perform the inspection with great precision and keep you educated on all of the findings and services needed. Give us a call today. ### Related Posts: [## Your Complete Guide to Septic System Inspections in Florida: What Contractors and Property Owners Ne...](https://southernsepticanddesign.com/septic-services-blog/your-complete-guide-to-septic-system-inspections-in-florida-what-contractors-and-property-owners-need-to-know/)[## Everything You Need to Know About Our Septic System Inspections \[infographic\]](https://southernsepticanddesign.com/septic-services-blog/everything-you-need-to-know-about-our-septic-system-inspections-infographic/) **Categories:** Septic Services Blog **Tags:** septic system inspections --- ### [3 Commercial Septic Services to Look for in Your Septic Company](https://southernsepticanddesign.com/septic-services-blog/3-commercial-septic-services-to-look-for-in-your-septic-company/) **Published:** January 15, 2020 **Author:** Southern Water Soil **Content:** ![Consider looking for companies that offer these three key commercial septic services](/wp-content/uploads/2019/09/2012-11-21-10.30.10-res.jpg) The key to successfully managing your commercial septic system is choosing an experienced and reliable company that can provide any services you might need. Consider looking for companies that offer these three key [commercial septic services](/commercial-septic-lutz-fl/). 1. **Septic system design**-Look for a company with trained engineers who can help you with your commercial septic system design. Engineers will know what will best benefit your property, such as lift station pumps and a variety of treatment systems. At Southern Water and Soil, our engineers can also help you decide between an alternative or a gravity-fed system based on environmental needs. 2. **Septic tank installations**-During the installation, the biggest concern should be that everything is done properly according to regulations and with necessary permits. Our team at Southern Water and Soil strives to protect Florida’s waters, which motivates us to be particular that any installations we do are done correctly. Our good relationship with local health departments allows us to easily obtain any permits needed. 3. **Septic system repairs**– One of the most critical of commercial septic services is septic system repairs. It is important to get repairs done quickly by an expert team, as one damaged aspect can lead to problems in the rest of the system. At Southern Water and Soil, we offer emergency service throughout the Tampa area. We also have a good reputation for fixing problems that may have been caused by the work of less experienced companies. At Southern Water and Soil, we offer all of these commercial septic services and more. We have the expertise and experience you need to [have a well-managed septic system](/commercial-septic-lutz-fl/). We can also work with you to create a maintenance schedule that ensures your commercial septic system effectiveness. **Categories:** Septic Services Blog **Tags:** Commercial Septic Services --- ### [Installing Drain in Limited Space: Engineered Drip Septic Systems](https://southernsepticanddesign.com/septic-services-blog/installing-drain-in-limited-space-engineered-drip-septic-systems/) **Published:** February 17, 2020 **Author:** Southern Water Soil **Content:** ![engineered drip septic systems are fully controllable as to the amount of waste going into the soil](/wp-content/uploads/2019/09/2013-07-29-14.16.54-res.jpg) To understand [engineered drip septic systems](/septic-services-tampa-fl/septic-engineering/), let’s start by determining the difference between an engineered septic system and a non-engineered septic system. Both follow the same health code regulations and must be installed according to code. An engineered septic system is intended for challenging lots. Certain types of soil that hold onto water too long, difficult slopes or a high water table on the lot, a lot that is smaller than usual for the amount of water processed, or existing structures or trees that the system needs to be navigated around are some of the challenges that might exist. At Southern Water and Soil, we have engineers on staff who have the experience and understanding necessary to work through these problems to design a system that you can rely on for years to come. Engineered drip septic systems are septic systems that release wastewater in small amounts at a time. The purpose of this is to maximize the treatment of the wastewater before it is distributed back into the soil. This is much better for the environment as the water is treated before being slowly released. With the use of a control panel, [engineered drip septic systems are fully controllable](/septic-services-tampa-fl/septic-engineering/) as to the amount of waste going into the soil. The panel can monitor daily flow, temperature, pressure changes and system performance. At Southern Water and Soil, you can rely on our expert engineers to design a well-performing engineered drip septic system for your lot, despite difficult challenges. With the cooperation of our contractors and our well trained, professional team members, your engineered drip septic system will be installed efficiently and with great care. Contact us today! **Categories:** Septic Services Blog **Tags:** Engineered Drip Septic Systems --- ### [3 Factors that Can Affect Your Commercial Septic System Design](https://southernsepticanddesign.com/septic-services-blog/3-factors-that-can-affect-your-commercial-septic-system-design/) **Published:** March 16, 2020 **Author:** Southern Water Soil **Content:** ![you will need to alter your commercial septic system design](/wp-content/uploads/2020/02/2011-02-22-17.55.54_resize.jpg) Even though most septic systems are going to have many of the same components, there are considerations that you might need to make when it comes to the design of your septic system. Just like building plans need to take the property into consideration before building, so too will your [commercial septic system design](/commercial-septic-tampa-fl/commercial-septic-system-design/). Here at Southern Water and Soil, we want to help you get the right commercial septic system design for your property to ensure proper functioning. Here are a few things that have the potential to alter a design. 1. **The grade of the property.** One of the problems that we run into frequently when it comes to commercial septic system design is the grade of the property. A septic system often relies on gravity to drain the effluent water from the tank into the drain field, but sometimes the drain field needs to be positioned above the tank. This means an alteration to your commercial septic system design. 2. **The water table.** The location and depth of the water table is not always the same in properties, even when they are in the same region. This can force us to look for different design opportunities for your commercial septic system. 3. **The content of the soil.** When you have soil content that is going to be resistant to percolation of the effluent water, [you will need to alter your commercial septic system design](/commercial-septic-tampa-fl/commercial-septic-system-design/). This accommodation is a necessary one, especially if you would like to prevent flooding around the drain field. Here at Southern Water and Soil, we have over 30 years of experience working with commercial septic systems of all types. Let us make sure your design is the one that will perfectly suit your needs and your property. ### Related Posts: [## Does Your Commercial Septic System Design Meet Your Requirements?](https://southernsepticanddesign.com/septic-services-blog/does-your-commercial-septic-system-design-meet-your-requirements/)[## Get the Right System When You Choose the Right Commercial Septic System Design](https://southernsepticanddesign.com/septic-services-blog/get-the-right-system-when-you-choose-the-right-commercial-septic-system-design/) **Categories:** Septic Services Blog **Tags:** Commercial Septic System Design --- ### [Getting the Right Commercial Septic System Engineering for Your Needs](https://southernsepticanddesign.com/septic-services-blog/getting-the-right-commercial-septic-system-engineering-for-your-needs/) **Published:** April 15, 2020 **Author:** Southern Water Soil **Content:** ![handle all your commercial septic system engineering needs](/wp-content/uploads/2020/02/2011-03-17-17.29.12_resize.jpg) When you are in the process of building a new property or a new septic system for that property, you need the expertise of a team like ours here at Southern Water and Soil. Not only do we help you with the feat of designing a commercial septic system, but we are able to help with all the commercial septic system engineering details as well. Whether you have a property that is small and straightforward or large and complex, we are ready and able to assist you. Because we have been helping customers like you in the area for over 30 years, we are better equipped to [handle all your commercial septic system engineering needs](/commercial-septic-tampa-fl/commercial-septic-system-engineering/). We can create customized options that will take the grade of the land or the water table into consideration for your commercial septic system design and then get started on the engineering process. We understand that you might want to see a few options, and we are willing to put together your options so that you can make an educated decision. Once you have chosen your ideal system, we here at Southern Water and Soil are prepared to take on the other details of commercial septic system engineering, which will help you get the right system for your needs. We draw up plans, complete the obtaining of necessary permits, and will be able to help you through the construction process as well. If you are looking for the right [commercial septic system engineering](/commercial-septic-tampa-fl/commercial-septic-system-engineering/) to meet your needs, contact us here today at Southern Water and Soil. **Categories:** Septic Services Blog **Tags:** Commercial Septic System Engineering --- ### [Commercial Septic Permits: What You Need to Know Before Getting Started](https://southernsepticanddesign.com/septic-services-blog/commercial-septic-permits-what-you-need-to-know-before-getting-started/) **Published:** May 15, 2020 **Author:** Southern Water Soil **Content:** ![commercial septic permits are required before starting construction and installation](/wp-content/uploads/2020/02/2011-11-02-14.58.46_resize.jpg) A commercial septic system is essentially a miniaturized wastewater treatment plant that is buried on your property. Without a properly functioning and well-maintained system, you can run into issues with waste disposal as well as groundwater pollution problems. It is no wonder, then, that[ commercial septic permits are required before starting construction and installation](/commercial-septic-tampa-fl/commercial-septic-permits/) of your commercial septic system. Here at Southern Water and Soil, we want to make sure you that have everything you need before getting started on your commercial septic system, and that includes your commercial septic permits. Your commercial septic permits need to be taken care of before you even start construction or digging for your commercial septic system. Not only will you need to have paid your fee for the permit, but you will also need to supply (depending on the area) plans that show the location of water features, such as wells, piping, and plumbing access points for your septic system. Your plans will also need to show landmarks both permanent and temporary that are located on your property, such as the property itself, streets surrounding, any sheds or temporary structures, etc. You will also be required to supply plans of the septic system designs and proof of percolation tests. Here at Southern Water and Soil, we take the time to handle your [commercial septic permits](/commercial-septic-tampa-fl/commercial-septic-permits/) so that you don’t have to worry. With over three decades of experience, you are in good hands with our team. Contact us today if you have any questions about your septic permits. **Categories:** Septic Services Blog **Tags:** Commercial Septic Permits --- ### [Is a Commercial Septic Tank Repair in Your Future?](https://southernsepticanddesign.com/septic-services-blog/is-a-commercial-septic-tank-repair-in-your-future/) **Published:** June 15, 2020 **Author:** Southern Water Soil **Content:** ![commercial septic tank repair that is needed](/wp-content/uploads/2020/02/2012-01-26-13.05.47_resize.jpg) When you have a commercial septic system, you know the importance of regular maintenance and repairs. Sometimes, if you are new to septic systems or have fallen behind on the maintenance, you might find yourself in a situation where you are in need of a commercial septic tank repair. Here at Southern Water and Soil, we want to help you prevent repairs whenever possible through regular maintenance and helpful information. If you have a [commercial septic system](/commercial-septic-tampa-fl/), be sure to be on the lookout for these warning signs that can be a signal of commercial septic tank repairs in your future. - **Weird Noises.** Noises in your pipes are sometimes a condition of the property, and sometimes they signal something more sinister like an issue with your commercial septic system. It is always better to be safe than sorry when it comes to your septic system, so please let us know about new, different or strange noises coming from your pipes. - **Foul Odors.** When you have foul odors emanating from your drains, sometimes it can be the signal of a [commercial septic tank repair that is needed](/commercial-septic-tampa-fl/), especially if the odors are coming from drains that are usually just dealing with water, such as the bathroom sinks. - When water is flushed emptied into a drain, it should only go towards your septic system. If water is ever flowing backwards (backflow), even slightly, alarm bells in your mind should sound for others that you are concerned about, please give us a call here at Southern Water and Soil. immediate attention. If you have issues like these ones or others that you are concerned about, please give us a call here at Southern Water and Soil. **Categories:** Septic Services Blog **Tags:** Commercial Septic Tank Repair --- ### [Does Your Commercial Septic Company Have What You Need?](https://southernsepticanddesign.com/septic-services-blog/does-your-commercial-septic-company-have-what-you-need/) **Published:** July 15, 2020 **Author:** Southern Water Soil **Content:** ![We are a commercial septic company that enjoys our work](/wp-content/uploads/2020/02/2012-01-26-13.37.28_resized.jpg) When it comes to taking care of your septic system, you need to have a septic system company that has the services to meet your needs. While there are many residential septic systems out there, there are far fewer septic system companies that are able to take care of the commercial septic system requirements you might have. Here at Southern Water and Soil, we want to be your [commercial septic company](/commercial-septic-brandon/commercial-septic-company/) of choice. We believe that we have many features that set us apart from other septic system companies in the area, including: - **Experience.** With over three decades of combined service to our commercial clients, you can count on us for any commercial septic system needs that you might have. Our commercial septic company can do everything you need from design and gathering permits to the actual installation, maintenance and repairs. - **Expertise.** Working for so long with commercial septic systems, we have the expertise that you want when it comes to your septic system. Because we are able to pinpoint an issue quickly and know how to solve the problem, many people have turned to us when they were disappointed by other commercial septic companies that were not able to deliver. - **Enjoyment.** [We are a commercial septic company that enjoys our work](/commercial-septic-brandon/commercial-septic-company/)! We like diagnosing problems and helping solve the puzzle of a complex installation. No matter what type of help you’re looking for, we enjoy the fact that we can do it and do it well. To learn more about our commercial septic company here at Southern Water and Soil, please give us a call today! **Categories:** Septic Services Blog **Tags:** Commercial Septic Company --- ### [The Advantages of Package Plant Installations](https://southernsepticanddesign.com/septic-services-blog/the-advantages-of-package-plant-installations/) **Published:** August 14, 2020 **Author:** Southern Water Soil **Content:** ![The Advantages of Package Plant Installations](/wp-content/uploads/2020/08/2012-11-21-10.29-res.jpg) If you are investing in a new commercial water treatment or septic treatment system, package plant installations may offer benefits and help you comply with all the many water quality regulations set forth for commercial enterprises by the United States Environmental Protection Agency (EPA). Package plant installations can allow you to treat water and wastewater for a variety of contaminants like iron and manganese and other problems like turbidity, color and the presence of coliform organisms. [Package plant installations](/package-plant-installations-tampa-fl/) can also be used for the purposes of disinfection, filtration, aeration, ion exchange, adsorption and water softening. Package plant installations have many advantages when compared to other types of systems, including the following: - They can be customized during manufacturing to complete a variety of operations, depending on your unique needs. - They can be shipped preassembled, prewired and prepiped. This means they arrive on your site ready to operate after a relatively straightforward installation process. - They do not require much maintenance or much daily oversight. They are easy to use and can even be installed on a temporary basis if needed. - They are generally compact, meaning that you don’t need a huge area to take advantage of this technology. [Package plant installations offer a cost-effective](/package-plant-installations-tampa-fl/), easy-to-use alternative to in-ground treatment options. Talk to an experienced commercial septic services professional to determine if a package plant is the best option for your unique needs. ### Related Posts: [## What Creates the Need for Package Plant Installations?](https://southernsepticanddesign.com/septic-services-blog/what-creates-the-need-for-package-plant-installations/) **Categories:** Septic Services Blog **Tags:** Package Plant Installations --- ### [How Commercial Septic Systems are Different than Residential Ones](https://southernsepticanddesign.com/septic-services-blog/how-commercial-septic-systems-are-different-than-residential-ones/) **Published:** September 15, 2020 **Author:** Southern Water Soil **Content:** ![How Commercial Septic Systems are Different than Residential Ones](/wp-content/uploads/2020/08/resized-res.jpg) Many people have at least a basic understanding of how residential septic systems function. Waste flows into the tank from you house. The solids settle in the tank and are broken down by bacteria over time. The liquid component is filtered via the septic drain field and released into the ground. Just as residential septic systems offer a septic solution for houses that are not located in areas that are close enough to use the municipal sewers, [commercial septic systems ](/commercial-septic-tampa-fl/)must be used for commercial enterprises that are further away from any towns, or sometimes if their expected output of wastewater will be too great for the local municipal sewer system to handle. Commercial septic systems are highly regulated by the Florida Department of Environmental Protection, and there are permits and requirements that must be met before you can begin a commercial septic project. Here are some of the types of commercial buildings that often require commercial septic systems: - Apartment complexes - Retail stores - Hotels - Restaurants - Office buildings - Laundromats - Manufacturing facilities [Commercial septic systems often work very similarly to residential ones](/commercial-septic-tampa-fl/), just on a larger scale. You would expect an apartment building to create more wastewater than a single-family home, obviously. The higher the volume of wastewater, the larger the tank will need to be. There may need to be more regular maintenance for a commercial system. Restaurants and other types of commercial businesses may use more fats, oils and grease that clog up the system. As a commercial building owner, there are steps you can take to protect your septic system. Monitor water usage and stay alert for problems like leaks. Also, choose more efficient toilets and faucets to reduce total water usage. ### Related Posts: [## Installing Commercial Septic Systems](https://southernsepticanddesign.com/septic-services-blog/installing-commercial-septic-systems/) **Categories:** Septic Services Blog **Tags:** Commercial Septic Systems --- ### [Passive Nitrogen Septic Systems are Gaining Popularity for Good Reasons](https://southernsepticanddesign.com/septic-services-blog/passive-nitrogen-septic-systems-are-gaining-popularity-for-good-reasons/) **Published:** October 15, 2020 **Author:** Southern Water Soil **Content:** ![Passive Nitrogen Septic Systems are Gaining Popularity for Good Reasons](/wp-content/uploads/2020/08/2011-08-04-11.36-res.jpg) Starting mostly with concerns about agricultural runoff, we have become more and more aware of the potential problems that excessive levels of nitrogen can have on soil and water in our community. Studies in Florida have looked at this problem because excess nitrogen in the soil can cause plants to focus their energy on growing leaves (reducing the growth in other areas like flowers, fruit and root growth). Over time, this can weaken trees, making them more likely to fall or fail. Also, with the importance of citrus and other agricultural activity, we want plants to produce lots of good fruit. Excess nitrogen in water also causes problems, including overstimulating the growth of algae and aquatic plants and reducing the oxygen level in the water (which is not good for aquatic animals). The good news is that there is something we can do to reduce the amount of nitrogen released around septic systems – we can use [passive nitrogen septic systems](/septic-services-tampa-fl/septic-engineering/passive-nitrogen-septic-systems/). The Florida studies have shown that this type of septic system can reduce nitrogen levels by as much as ninety-five percent. Passive nitrogen septic systems are becoming more and more popular in Florida and other areas as these advantages are being recognized and promoted. Traditional septic systems create a lot of nitrogen in the area around their drain fields.[ Passive nitrogen septic systems work actively against this problem](/septic-services-tampa-fl/septic-engineering/passive-nitrogen-septic-systems/). Materials like wood chips, sulfur or limestone can be used to help mitigate the problem. Every situation is different, but passive nitrogen septic systems have proven to be a great option. Consult with a professional septic company to see what the best choice for your building and lot may be. **Categories:** Septic Services Blog **Tags:** Passive nitrogen septic systems --- ### [What to Expect During Your Commercial Septic Tank Installation](https://southernsepticanddesign.com/septic-services-blog/what-to-expect-during-your-commercial-septic-tank-installation/) **Published:** November 16, 2020 **Author:** Southern Water Soil **Content:** ![What to Expect During Your Commercial Septic Tank Installation](/wp-content/uploads/2020/08/2012-11-13-14.34-res.jpg) Because they are generally bigger in size and scope, it is not surprising that commercial septic tank installation is usually a little more complex and time-consuming than residential septic tank installation. There is generally more planning needed before starting this type of project. Paperwork must be completed, and permits have to be pulled before any work can be started. The first step in [your commercial septic tank installation should be careful planning](/commercial-septic-tampa-fl/commercial-septic-tank-installations/). We will come out and evaluate your site. We will need to know what type of commercial enterprise you are planning. A laundromat will generate a lot more wastewater than a retail store, for example. We will need to examine any zoning rules or environmental regulations that are in place for your lot. We will also need to think carefully about what type of system best suits your needs, your lot and your budget. Here are some of the types of commercial septic tank installation options we can provide: - Aerobic Treatment Units - Advanced Treatment Systems - Performance-Based Treatment Systems - Secondary Treatment Systems - Low-Pressure Dosing Systems - Drip Irrigation Systems - Passive Nitrogen Systems We will need a full picture of how you plan to use your commercial building. Will it be a restaurant, office space, apartments, or a mixed-use building? Each type of building has unique needs– for example, restaurants generally create more fats, oils and grease that can clog a system. Before your [commercial septic tank installation](/commercial-septic-tampa-fl/commercial-septic-tank-installations/), you should know that commercial systems usually require more maintenance than residential ones. Careful planning will be key to your success. ### Related Posts: [## Hire a Professional for Your Commercial Septic Tank Installation](https://southernsepticanddesign.com/septic-services-blog/hire-a-professional-for-your-commercial-septic-tank-installation/) **Categories:** Septic Services Blog **Tags:** Commercial Septic Tank Installation --- ### [The Orenco AdvanTex AX-MAX May be the Perfect Fit for Your New Business](https://southernsepticanddesign.com/septic-services-blog/the-orenco-advantex-ax-max-may-be-the-perfect-fit-for-your-new-business/) **Published:** December 15, 2020 **Author:** Southern Water Soil **Content:** ![The Orenco AdvanTex AX-MAX May be the Perfect Fit for Your New Business](/wp-content/uploads/2020/08/2012-11-21-10.30-res.jpg) One of our most popular options for commercial septic needs is the Orenco AdvanTex AX-Max. This system has been proven dependable and is full of the latest technology in commercial septic systems. It is made of fiberglass that is watertight and very durable and sturdy. The Orenco AdvanTex AX-Max is a great option for many types of commercial developments, including truck stops, rest areas, campgrounds, RV parks, mobile home parks, subdivisions, apartment buildings, resorts, schools, churches, hotels and other businesses. If your business cannot access the municipal sewer system or you anticipate generating more wastewater than the municipal sewer can handle, the Orenco AdvanTex AX-Max may be your solution. Here are some of the [advantages of the Orenco AdvanTex AX-Max system](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/): - A single unit can handle 5,000-15,000 gallons per day (depending on the exact model that is selected and installed). - Because these units are modular by design, it is easy to install multi-unit systems that allow you to handle even higher volumes of wastewater each day. - Because this is a complete, pre-built system, it can handle primary-treated effluent to better than secondary standards and can include nitrogen reduction all in one unit. - This unit features the recirculation blend and the discharge tankage in a single module. It includes the pump system, the needed ventilation, and a lightweight, high-absorption engineered textile media all in one. All these features mean that you can treat a high volume of wastewater in a small space. The [Orenco AdvanTex AX-Max](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/) is perfect for large-flow sites that don’t have much room. **Categories:** Septic Services Blog **Tags:** Orenco AdvanTex AX-Max --- ### [Proposed Senate Bill Expedites the Inspection Process for Septic Systems](https://southernsepticanddesign.com/septic-services-blog/proposed-senate-bill-expedites-the-inspection-process-for-septic-systems/) **Published:** February 21, 2022 **Author:** Southern Water Soil **Content:** Installing a new septic system at a building site or replacing an existing septic system is a big undertaking. Part of this process involves obtaining the proper permits and inspections from the local municipality and submitting a detailed site plan that showcases all of the features on the property being developed as part of the project. ![Inspection Process for Septic Systems](/wp-content/uploads/2022/02/2012-01-26-13.05.47-res.jpg) If you have ever installed a new septic system at a building site before, you know that getting the proper municipal authority out to inspect the site can take time, and because of scheduling and holdups, this can even delay the construction process. To streamline the permitting process, the Florida Senate has proposed a bill that would give home and business owners the option to work with a Master Septic Contractor or Certified Environmental Health Professional of their choosing. This would help expedite the septic building and replacement process and allow home and business owners to work with a septic professional they already know and trust. Our owner and founder, Greg Mayfield, R.S., M.S.C., C.E.H.P., has worked for the Florida Department of Health as a septic inspector, and he is excited to help home and business owners directly with this new process. Greg and the rest of our team at Southern Water and Soil recognize that septic inspections are an essential part of the building or replacement process because they ensure these systems are up to code to promote proper functionality and longevity of the septic and drain field system. If you have any questions about this new Senate bill and how it could impact your septic building or replacement project, please don’t hesitate to reach out to us. **Categories:** Septic Services Blog --- ## Pages ### [Southern Water and Soil](https://southernsepticanddesign.com/) **Published:** November 15, 2016 **Author:** Southern Water Soil **Content:** ## [Septic Inspections](/septic-inspections-dade-city-fl/) We know exactly what to look for when performing septic inspections. [Learn More](/septic-inspections-dade-city-fl/) ## [Drain Fields](/residential-septic-services-dade-city-fl/drain-fields/) When working on drain fields, we ensure the best placement and design. [Learn More](/residential-septic-services-dade-city-fl/drain-fields/) ## [Package Plant Installations](/package-plant-installations-dade-city-fl/) Our team has over three decades of experience performing package plant installations in Dade City, FL and is committed to your complete satisfaction. [Learn More](/package-plant-installations-dade-city-fl/) ## [Septic Engineering](/residential-septic-services-dade-city-fl/septic-engineering/) Our septic engineering services offer expert design of your septic system from start to finish. [Learn More](/residential-septic-services-dade-city-fl/septic-engineering/) ## [Construction Management](/construction-management-dade-city-fl/) Ensure the efficiency and effectiveness of your wastewater construction project. [Learn More](/construction-management-dade-city-fl/) ## [Septic Inspections](/septic-inspections-dade-city-fl/) We know exactly what to look for when performing septic inspections. [Learn More](/septic-inspections-dade-city-fl/) # We get impeccable resultsthrough our proven processes. Although the design and engineering of new septic systems has been our focus for many years, we also provide a wide range of other services to help homeowners maintain the use of their **septic systems**. For example, we engineer and permit new septic systems, replace aging septic systems, install new systems and [drain fields](/commercial-septic-tampa-fl/commercial-septic-drain-field/), inspect septic systems for real estate, complete septic system repairs, work on septic system alarms, and even pump septic tanks. Under the supervision of our experienced leadership, we work with carefully vetted partners to provide these [residential septic services](/residential-septic-services-dade-city-fl/). We also specialize in new and replacement onsite sewage treatment and disposal systems (OSTDS) to comply with recent changes to local septic system requirements. Additionally, we have [Master Septic Contractors](/master-septic-contractor-tampa-fl/)/certified environmental health professionals on staff and offer septic inspections as part of the building or replacement process. Our staff members possess the credentials to ensure septic systems are up to code to not only ensure they will pass the permitting process, but that they will continue to work properly on a long-term basis. ![](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/05/152043-opt.jpg?lossy=1&strip=0&webp=1 "152043-opt") ![Southern Water and Soil](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) ## Serving Tampa, FL with 30 years of combined experience in the septic industry. We exceed our customers’ expectations with septic systems that are properly designed & cost-effective. ![Southern Water and Soil](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/04/Stars-2.png?lossy=1&strip=0&webp=1) ![Southern Water and Soil](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/04/Earth-Icon.png?lossy=1&strip=0&webp=1) [![Residential Septic Services](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/04/BMAP-Experts-1.png?lossy=1&strip=0&webp=1)](/septic-experts-florida-wastewater/) ### [BMAP Experts](/septic-experts-florida-wastewater/) Many home & business owners with existing **septic systems** are vulnerable to failure or compromise will need to update or redesign of their current systems. We can help! [Learn More](/septic-experts-florida-wastewater/) [![Septic Engineering](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/04/Commercial-Septic-Permits-1.png?lossy=1&strip=0&webp=1)](/commercial-septic-dade-city-fl/commercial-septic-permits/) ### [Commercial Septic Permits](/commercial-septic-dade-city-fl/commercial-septic-permits/) Do you need a **Septic Permit** for a commercial project? This is one of our areas of expertise! Find our requisition form to get your documents over to us and we’ll be happy to assist. [Learn More](/commercial-septic-dade-city-fl/commercial-septic-permits/) [![Septic Drain Field](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/04/Commercial-Septic-Inspections-1.png?lossy=1&strip=0&webp=1)](/commercial-septic-inspection-intake/) ### [Commercial Septic Inspections](/commercial-septic-inspection-intake/) We handle all kinds of septic inspections as Master **Septic Contractors**. In order to get things started, fill out our form to get us all the details and we will be in touch. [Learn More](/commercial-septic-inspection-intake/) [![Residential Septic Services](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/04/Residential-Septic-Services-1.png?lossy=1&strip=0&webp=1)](/construction-management-dade-city-fl/) ### [Construction Management](/construction-management-dade-city-fl/) When you turn to us to design and install your **residential septic system**, we will provide you with as much service as the project requires and use our experience to get the job done right. We offer 24-hour emergency residential septic services so we can get to your home quickly and solve the problems as soon as possible. [Learn More](/construction-management-dade-city-fl/) [![Septic Engineering](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/04/Septic-Engineering-1.png?lossy=1&strip=0&webp=1)](/residential-septic-services-dade-city-fl/septic-engineering/) ### [Septic Engineering](/residential-septic-services-dade-city-fl/septic-engineering/) Septic tanks are common throughout rural areas, since they provide a practical solution for homes and offices that are far away from waste processing facilities. At Southern Water & Soil, we offer septic engineering to build and install the perfect **septic system** for your residential or commercial property in the Tampa, FL area. [Learn More](/residential-septic-services-dade-city-fl/septic-engineering/) [![Septic Drain Field](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/04/Nitrogen-Reducing-Septic-1.png?lossy=1&strip=0&webp=1)](/nitrogen-reducing-septic-system-dade-city-fl/) ### [Nitrogen Reducing Septic](/nitrogen-reducing-septic-system-dade-city-fl/) We are experts in designing, installing, and maintaining nitrogen-reducing septic systems that are cost-effective, and installed with minimal disruption. [Learn More](/nitrogen-reducing-septic-system-dade-city-fl/) ## Your single source for comprehensive septic solutions. For all things septic in the Dade City, Florida area, we are your trusted, reliable, and experienced source. [Contact us today](/contact-southern-water-and-soil/) to set up an appointment to discuss your plans for the design and engineering of a new septic system or to schedule septic repairs, pumping, or another[ residential septic service](/residential-septic-services-dade-city-fl/). [Schedule An Appointment](/contact-southern-water-and-soil/) ![Southern Water and Soil](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) ![Southern Water and Soil](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) ## At Southern Water Solutions Inc., we have over three decades of experience designing and engineering septic systems. We do things right the first time, every time, and proudly take on everything from smaller, residential jobs to larger package plant installations. We put our knowledge of applicable codes and advances in waste management technology to good use when designing and installing new septic systems. 4.2★★★★☆![Lili. Actress](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==)[Lili. Actress](https://search.google.com/local/reviews?placeid=ChIJ6_JDKTu5wogR_mXDWB1mKpQ) ★★★★★ son los mejores ademas tienen dentro de su equipo personas de habla hispana, son muy profesionales y rápidos,siempre los permisos en tiempo. los recomiendo siempreeee![Kevin Alderman](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==)[Kevin Alderman](https://maps.google.com/maps/contrib/101246897837909533524) ★★★★★ Greg and the entire team impressed me with their design, estimates and delivery. There are few as knowledgeable. Highly recommend.![Lisa Lowery](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==)[Lisa Lowery](https://search.google.com/local/reviews?placeid=ChIJ6_JDKTu5wogR_mXDWB1mKpQ) ★★★★★ They have been doing work for us for 10 years now on different properties and amazing company! Always responsive, on time and usually under budget. Great company to do business with!![Alexis Chambers](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==)[Alexis Chambers](https://search.google.com/local/reviews?placeid=ChIJ6_JDKTu5wogR_mXDWB1mKpQ) ★★★★★ Fast professional service for a great price. Walter was absolutely wonderful, professional, punctual and friendly. He had no problem when my son was curiously watching him the whole time and made an annoying job painless. Thank you thank you!Response from the ownerAlexis, thanks for being our customer. ![John Jolly](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==)[John Jolly](https://search.google.com/local/reviews?placeid=ChIJ6_JDKTu5wogR_mXDWB1mKpQ) ★★★★★ I had Greg and his team install a completely new system at my house. Tyler and the crew that did the job were fantastic. I even accidentally caused some damage to my drain field and Greg and Tyler immediately came out and fixed my mistake. Quality work that they stand behind for a fair price. Highly recommendResponse from the ownerJohn,We appreciate your business. We are always here to help. ![Thomas P Ross](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==)[Thomas P Ross](https://search.google.com/local/reviews?placeid=ChIJ6_JDKTu5wogR_mXDWB1mKpQ) ★★★★★ I am very pleased with Southern Water & Soil. I had a complete drain field installed with lift station. His crew was great and did the job in a professional manner. After the job was complete we had more rain water coming onto our driveway than before, this was making it very soggy around the driveway area. This was due to the height of the new drain field and the slope back to the driveway. I called Greg and he took care of the issue by installing a pipe and a couple catch basins where the water was pooling thus channeling the excess water away to the culvert. He suggested this, scheduled it and had this done with no hassles and no extra charge! It took care of the problem. Greg stands by his work and makes it right without complaint. I had a couple other questions for him and he always returned my call promptly and resolved them. It is well over a year now and the system is working fine. Excellent service and I would highly recommend (and have) his company to anyone needing his services.![js_loader](data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA7) ### Learn More About What Our Septic Company Can Do for You We are experts in septic services whom you can trust for a wide variety of major projects. Check out our frequently asked questions to learn more about how we can serve you. ##### Hidden ##### What should I know about Florida’s Basin Management Action Plans (BMAPs)? The state of Florida has mandated a significant reduction in the level of pollutants found in the watershed. Because septic systems result in excess nutrients that pollute the environment, some properties are required to make changes to their septic systems to minimize pollution. As BMAP experts, we can implement a variety of solutions that meet the new standards. ##### Do handle septic system permitting? Yes. We are Certified [Master Septic Contractors](/master-septic-contractor-dade-city-fl/) licensed by the state of Florida. As such, we are familiar with the regulations that must be followed and can perform septic permitting before your septic project begins. ##### Can you provide commercial septic inspections? Yes, we are licensed to carry out [commercial septic](/commercial-septic-dade-city-fl/) inspections upon completion of new [septic systems](/residential-septic-services-dade-city-fl/septic-systems/) or for real estate purposes. ##### Why should I trust your team for commercial septic system engineering? We have over three decades of combined experience in the septic industry, so you can trust in our expertise and rest assured that we have the skills, state-of-the-art equipment, and drive to meet your project’s needs. In addition, we manage septic projects in an efficient, organized, and cost-effective manner. ##### What can I expect from your construction management services? When you choose our experienced company for [construction management](/construction-management-dade-city-fl/), we will handle the planning, design, and construction of your wastewater infrastructure with the utmost attention to detail and dedication to quality. We complete projects on schedule and within budget. ## Contact Us Today "\*" indicates required fields Δ Name\* Phone\* Email\* Address\* City\* Zip Code\* Services\* Residential Commercial How can we help?\* --- ### [Septic Tank Design, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-system-design/septic-tank-design/) **Published:** August 15, 2016 **Author:** Southern Water Soil **Content:** ## We have experienced engineers on hand who can assist with septic tank design and septic system installation from start to finish in Dade City. ![Septic Tank Design in Dade City, Florida](/wp-content/uploads/2016/08/2012-01-26-13.06.02_resized.jpg)One of the most important steps when you are installing a new septic system at your residential or commercial property is the **septic tank design**. This critical component ensures that your tank is big enough to meet your needs, is properly placed to catch and remove waste from your home or business, and will have a long lifeline once it is installed. At Southern Water and Soil, we aren’t just your typical septic company that can complete routine maintenance. We have experienced engineers on hand who can assist with septic tank design and septic system installation from start to finish. This will give you confidence that your property in Dade City, Florida is in good working order. Not only do we have licensed septic tank contractors on-staff, but we also make sure that all of the legal requirements and application processes are completed before beginning installation. More importantly, we’ll keep you informed through every stage, so you feel certain that the job is done right, and done well. At Southern Water and Soil, we offer alternative septic tank design, and we also carry a number of top brand names for you to choose from. We can even assist you in selecting the septic system design that will best meet your needs. At Southern Water and Soil, we know the process of installing a new septic system can be a big task. There are a lot of people involved, and you most likely want the most qualified and experienced team to make sure your project is completed pain-free. Contact us today to learn more about how we can assist you with everything from **septic tank design** through installation and your completed project. We look forward to working with you. --- *At Southern Water and Soil, we offer **septic tank design** services in [Brooksville](/residential-septic-brooksville-fl/septic-system-design/septic-tank-design/), **[Dade City](/residential-septic-dade-city-fl/septic-system-design/septic-tank-design/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-system-design/septic-tank-design/), Orlando, Plant City, Spring Hill, and [Tampa](/residential-septic-tampa-fl/septic-system-design/septic-tank-design/), Florida.* --- ### [Septic Tank Design, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-system-design/septic-tank-design/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## A well-designed septic tank plan offers many benefits. Septic tank systems manage and treat residential wastewater, which protects both those living in the home and the environment. But the quality of their planning has a lot to do with how well these systems work. A thoughtful **septic tank design** is essential for good performance, durability, and environmental friendliness. At Southern Water and Soil, we have experienced engineers on hand to assist with septic tank design. ![Septic Tank Design in Brooksville, Florida](/wp-content/uploads/2024/02/2012-01-26-13.06.02-res.jpg) A thorough septic tank design considers things like the size of the family, the type of soil, and the rules in the area. By correctly figuring out these factors, the system can handle and treat wastewater more efficiently. The right septic tank will be able to handle the amount of sewage that a home produces, keeping the system from overflowing or failing. Good care not only protects people’s health but also keeps nearby water sources from becoming polluted. Septic tanks are an important part of autonomous wastewater treatment, especially in our **Brooksville, Florida** area. If the system isn’t planned well, it can hurt the environment by polluting the water and land. Our engineers can develop a septic tank design that is less harmful to the environment by considering things like the area’s terrain, groundwater depth, and how permeable the soil is during the design process. By doing this, we also protect habitats, water quality, and aquatic life. Designs and installations of septic tank systems must follow local and regional rules. For homeowners, following these rules and avoiding legal problems and possible fines is easier if they have a detailed septic tank plan. A well-designed system is also more likely to pass checks and get the building permits it needs. It’s impossible to say enough about how important it is to have a detailed **septic tank design**. It is the basis for a wastewater treatment system that works well, lasts a long time, and is good for the earth. [Contact our team](/contact-southern-water-and-soil/) today to learn more. --- *At Southern Water and Soil, we offer **septic tank design** services in [**Brooksville**](/residential-septic-brooksville-fl/septic-system-design/septic-tank-design/), [Dade City](/residential-septic-dade-city-fl/septic-system-design/septic-tank-design/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-system-design/septic-tank-design/), Orlando, Plant City, Spring Hill, and [Tampa](/residential-septic-tampa-fl/septic-system-design/septic-tank-design/), Florida.* --- ### [Septic Tank Design, Odessa, FL](https://southernsepticanddesign.com/residential-septic-odessa-fl/septic-system-design/septic-tank-design/) **Published:** August 12, 2015 **Author:** Southern Water Soil **Content:** ## With our septic tank design services in Odessa, FL, we can create a septic tank that meets your property’s specific needs. ![88014103-septic tank design](/wp-content/uploads/2015/02/88014103-septic-tank-design-199x300.jpg)The septic tank is one of the most important parts of your entire septic system. When wastewater leaves your home or business, it flows through your sewer pipe and into your septic tank. Here, the wastewater separates into three layers, and the clarified liquid in the middle eventually makes its way out into your property’s drain field. Since your septic tank plays such a crucial role in the wastewater treatment process, it’s essential that your septic tank is designed in a way that accounts for your home or business’ specific wastewater treatment and disposal needs. If you are interested in replacing your septic tank or using septic for the first time, let us at Southern Water and Soil assist you with the **septic tank design** process. During the septic tank design process, we will first consult with you to determine how you use your property and how much water you and your family members, or you and your employees, use on a daily basis. From there, we will carefully come up with plans for your septic tank that account for your specific situation. Once we finalize the design plans with you, we can then take care of installing the new system on your property in **Odessa, Florida**. At Southern Water and Soil, it is our goal to make using septic as easy on you as possible. To get the **septic tank design** process started or to find out more about the other services we provide, please [contact us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we offer **septic tank design** services in [Brooksville](/residential-septic-brooksville-fl/septic-system-design/septic-tank-design/), [Dade City](/residential-septic-dade-city-fl/septic-system-design/septic-tank-design/), Fort Myers, Land O’ Lakes, Lutz, Miami, **[Odessa](/residential-septic-odessa-fl/septic-system-design/septic-tank-design/)**, Orlando, Plant City, Spring Hill, and [Tampa](/residential-septic-tampa-fl/septic-system-design/septic-tank-design/), Florida.* --- ### [Septic System Warranty Packages, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/septic-system-warranty-packages/) **Published:** December 22, 2015 **Author:** Southern Water Soil **Content:** ## Have peace of mind knowing that your Odessa, FL septic system will be protected by one of our septic system warranty packages. ![Septic System Warranty Packages](/wp-content/uploads/2015/09/2014-01-11-00.12-resized-300x300.jpg)Having a new septic system installed is by no means an inexpensive project, so you want to know that you will be protected in case it ever fails. At Southern Water and Soil, we stand behind our products and do everything we can to ensure customer satisfaction. This includes offering **septic system warranty packages** for all of our systems. When you hire our team at Southern Water and Soil to repair or replace your commercial or residential septic system in Odessa, FL, you can rest easy knowing that you are hiring a team of experts. We have more than 30 years of combined experience in the septic industry and only work with the most knowledgeable engineers in the business. No matter how large or small your project is, we will work with you from start to finish to ensure your complete satisfaction. At Southern Water and Soil, we do our best to make sure that every septic system is properly installed and designed to last. Even the most expertly installed septic systems require routine maintenance, however, to keep the system clean and working efficiently, and to help prevent problems. In addition to offering a variety of septic services, we also offer septic system warranty packages. With one of our **septic system warranty packages**, you have peace of mind in knowing that you will be covered if something goes wrong with your system. Our team of experts is on-call for 24-hour emergency service, so don’t hesitate to [contact us](/contact-southern-water-and-soil/) if you experience a problem. We also offer maintenance services, including routine inspections and repairs to keep your septic system running smoothly. --- *At Southern Water and Soil, we offer **septic system warranty packages** in [Tampa](/septic-systems-tampa-fl/septic-system-warranty-packages), **[Odessa](/septic-systems-odessa-fl/septic-system-warranty-packages/)**, Lutz, Land O’ Lakes, [Brandon](/septic-systems-brandon-fl/septic-system-warranty-packages/), Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Septic System Warranty Packages, Land O’ Lakes, FL](https://southernsepticanddesign.com/septic-system-warranty-packages-2/) **Published:** June 8, 2016 **Author:** Southern Water Soil **Content:** ## We offer septic system warranty packages to meet your needs in Land O’ Lakes. ![Septic System Warranty Packages in Land O’ Lakes, Florida](/wp-content/uploads/2014/07/2013-08-22-19.07.25-300x168.jpg)Are you having a new septic system installed and you want to make sure that it is covered if something unexpected comes up? At Southern Water and Soil, we understand that a properly functioning septic system for your residential or commercial property is important, and that is why we offer **septic system warranty packages** to meet your needs. We offer a wide range of septic services to our clients in Land O’ Lakes, Florida, and we work to ensure we exceed our customers’ expectations. One way we can give you peace of mind is with our septic system warranty packages. At Southern Water and Soil, our team has years of experience and contains a variety of professionals, including an engineer, a licensed sanitation specialist, and more. Each staff member is cross-trained to provide the highest level of service on your property. We will communicate openly and make sure everyone understands the master plan and his or her role to achieve the finished product. Our septic system warranty packages vary based on which type of septic system you choose, but the best part is you don’t have to worry about the unexpected expense of something going wrong. We also offer routine maintenance services and strongly encourage everyone to schedule this maintenance yearly or as recommended for your system. This is also a good way to have our professional team check for preliminary issues and provide resolutions before it becomes a bigger problem. By utilizing our **septic system warranty packages** and having us complete routine septic maintenance in Land O’ Lakes, Florida, you can avoid having a messy and frustrating situation with your septic system. We can create a customized service contract for your commercial or residential property. [Contact us](/contact-southern-water-and-soil/) today to learn more! --- *At Southern Water and Soil, we offer **septic system warranty packages** in [Tampa](/septic-systems-tampa-fl/septic-system-warranty-packages), [Odessa](/septic-systems-odessa-fl/septic-system-warranty-packages/), Lutz, **[Land O’ Lakes](/septic-systems-land-o-lakes-fl/septic-system-warranty-packages/)**, [Brandon](/septic-systems-brandon-fl/septic-system-warranty-packages/), Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Septic System Warranty Packages, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/septic-system-warranty-packages/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Content:** ## Each of our septic system warranty packages offers peace of mind to the homeowner or property manager in Tampa, FL. ![2013-08-22 19.07.25](/wp-content/uploads/2014/07/2013-08-22-19.07.25-300x168.jpg)When you are looking to add to or replace a septic system on your commercial or residential property, give us a call at Southern Water & Soil. We offer a wide range of septic services to those in and near Tampa, Florida. Our team has years of experience and contains a variety of professionals, including an engineer, a licensed sanitation specialist, and more. Each staff member has thorough cross-training to ensure that everyone who comes to work on your property understands the master plan and how his or her role plays into the finished product. In addition to excellent quality and service, we also offer **septic system warranty packages**. These vary based on the system that you choose, but each of our septic system warranty packages offers peace of mind to the homeowner or property manager. You won’t have to worry about the added expense of something going wrong in your system, since the warranty covers these issues. Along with **septic system warranty packages**, we also offer routine maintenance of septic systems. We strongly encourage everyone with a septic system to schedule this routine maintenance, as it can keep septic tanks cleaner and more effective, which helps prevent problems. When our team performs a cleaning and pumping of a septic tank, we will inspect the system for signs of damage. If we can catch any possible issues early, you can avoid having a messy and frustrating situation with your septic system. Give us a call or fill out our [contact form](/contact-southern-water-and-soil/ "septic systems experts"), and we can create a customized service contract for your commercial or residential property. --- *At Southern Water and Soil, we offer **septic system warranty packages** in Brooksville, Dade City, Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/septic-system-warranty-packages/), Orlando, Plant City, Spring Hill, and [**Tampa**](/commercial-septic-tampa-fl/septic-system-warranty-packages/), Florida.* --- ### [Septic System Design, Lutz, FL](https://southernsepticanddesign.com/residential-septic-lutz-fl/septic-system-design/) **Published:** July 2, 2020 **Author:** Southern Water Soil **Content:** ## We have the expertise with septic system design to provide your commercial project with a reliable, long-lasting septic system. ![Septic System Design in Lutz, Florida](/wp-content/uploads/2014/07/2011-08-01-15.57.40.jpg) At Southern Water and Soil, our engineers are quite capable and knowledgeable about **septic system design**. You can be confident that should you need a septic system installed for a new **Lutz, Florida** project, we will properly analyze the job site and consider both regulations and your specific needs. With our 30 years of combined experience and our relationships with the Florida Department of Health and the Florida Department of Environmental Protection, we will make certain your septic system design meets all regulations to qualify for a local permit and will serve you well in the years ahead. One of the things that makes us your best choice for **septic system design** is that our president, Greg Mayfield, has worked for both the Florida Department of Health and the Southwest Florida Water Management District. That gives us insight into how to develop a septic system design that is safe for the environment. We can also provide you with in-depth information about how to care for your new septic system so that it continues to operate as it should without causing contamination of the soil or groundwater. We will also go over signs to watch out for that can indicate a problem. If you would like to know more about our septic system design services for your commercial property, or any of our commercial septic services, don’t hesitate to [reach out to us](/contact-southern-water-and-soil/). We are no strangers to even complex systems, such as package plant installations, and we look forward to providing you with a long-lasting, reliable septic system. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **septic system design** services in [Brooksville](/residential-septic-brooksville-fl/septic-system-design/), [Dade City](/residential-septic-dade-city-fl/septic-system-design/), Fort Myers, Land O’ Lakes, **[Lutz](/residential-septic-lutz-fl/septic-system-design/)**, Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-system-design/), and [Tampa](/residential-septic-tampa-fl/septic-system-design/), Florida.* --- ### [Septic System Design, Odessa, FL](https://southernsepticanddesign.com/residential-septic-odessa-fl/septic-system-design/) **Published:** December 22, 2015 **Author:** Southern Water Soil **Content:** ## If you need a custom septic system design in Odessa, FL, you can trust our team of engineers to get the job done right. ![Septic System Design](/wp-content/uploads/2015/06/clip_image002.jpg)If you are looking to have a new septic system installed on your residential or commercial property, be sure to make Southern Water and Soil your first call. Not only can our team of engineers help you with residential or commercial septic tank design, but they will also be able to assist you in planning your entire septic system. At Southern Water and Soil, we have a team of experts on hand who can help you with your **septic system design** from start to finish. We will come out to your property to assess your needs, and then create a custom septic system design just for you. We not only have plenty of on-staff engineers who will work diligently on your project, but we also have a network of licensed septic contractors who will make sure your new septic system meets local requirements and regulations. Because your septic system will be responsible for treating and disposing of waste, you need to make sure the people you hire to design it know what they are doing. We not only understand the ins and outs of septic systems, but will also answer all of your questions to make sure you understand them as well, so you can make an informed decision regarding the system that is best for your property. After we perform your **septic system design** and installation, you can rest easy knowing that we will always be available for supportive services. At Southern Water and Soil, we pride ourselves in offering our customers in Odessa, FL top-notch service in all stages of the project. If you ever find yourself in need of septic system cleaning, repair, or routine maintenance, just [give us a call](/contact-southern-water-and-soil/). No job is too big or too small, so don’t hesitate to reach out to us with questions or concerns. --- *At Southern Water and Soil, we offer **septic system design** services in [Tampa](/septic-systems-tampa-fl/septic-system-design/), **[Odessa](/residential-septic-odessa-fl/septic-system-design/)**, [Lutz](https://southernsepticanddesign.com/residential-septic-lutz-fl/septic-system-design/), Land O’ Lakes, [Brandon](/septic-systems-brandon-fl/septic-system-design/), Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Septic System Design, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-system-design/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## When we begin a septic system design project in Dade City, FL, we analyze the pros and cons of every option before giving you a proposal. When our engineers at Southern Water & Soil begin a septic system design project, they analyze the pros and cons of every option ![Septic System Design in Dade City, Florida](/wp-content/uploads/2014/07/2011-08-01-15.57.40-300x179.jpg)before giving you a proposal. If you have desires or concerns with your septic system, we will take that into consideration so that we can provide a system that works for you. If you don’t know much about septic systems but would like to know more, we offer education and training in the proper usage of a septic system. We can also provide information about potential concerns to watch for, such as foul odors near the tank, slow-moving or clogged drains, and bubbling or gurgling sounds coming from the tank or drain field. When we start a **septic system design** project, we can draw on our 30 years of combined experience to find an option that is perfect for your property. We have designed systems that use wastewater to provide drip irrigation, which is a great way to save water and keep plant life thriving. We work closely with the Florida Department of Health and the Florida Department of Environmental Protection, ensuring that every system we design meets all regulations and will qualify for a local permit. We offer septic system design for properties in **Dade City, Florida** and surrounding cities. Our president, Greg Mayfield, has years of work history in the area of septic systems and worked for both the Southwest Florida Water Management District and the Florida Department of Health. Please [contact us](/contact-southern-water-and-soil/ "aerobic septic systems experts") today if you have any questions about **septic system design** or any of our other services. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **septic system design** services in [Brooksville](/residential-septic-brooksville-fl/septic-system-design/), [**Dade City**](/residential-septic-dade-city-fl/septic-system-design/), Fort Myers, Land O’ Lakes, [Lutz](/residential-septic-lutz-fl/septic-system-design/), Miami, [Odessa](/residential-septic-odessa-fl/septic-system-design/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-system-design/), and [Tampa](/residential-septic-tampa-fl/septic-system-design/), Florida.* ### Similar Services We Offer: --- ### [Septic System Design, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-system-design/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Content:** ## When we begin a septic system design project in Tampa, FL, we analyze the pros and cons of every option before giving you a proposal. When our engineers at Southern Water & Soil begin a septic system design project, they analyze the pros and cons of every option ![Septic System Design](/wp-content/uploads/2014/07/2011-08-01-15.57.40-300x179.jpg)before giving you a proposal. If you have desires or concerns with your septic system, we will take that into consideration so that we can provide a system that works for you. If you don’t know much about septic systems but would like to know more, we offer education and training in the proper usage of a septic system. We can also provide information about potential concerns to watch for, such as foul odors near the tank, slow-moving or clogged drains, and bubbling or gurgling sounds coming from the tank or drain field. When we start a **septic system design** project, we can draw on our 30 years of combined experience to find an option that is perfect for your property. We have designed systems that use wastewater to provide drip irrigation, which is a great way to save water and keep plant life thriving. We work closely with the Florida Department of Health and the Florida Department of Environmental Protection, ensuring that every system we design meets all regulations and will qualify for a local permit. We offer septic system design for properties in Tampa, Florida and surrounding cities. Our president, Greg Mayfield, has years of work history in the area of septic systems and worked for both the Southwest Florida Water Management District and the Florida Department of Health. Please [contact us](/contact-southern-water-and-soil/ "aerobic septic systems experts") today if you have any questions about **septic system design** or any of our other services. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **septic system design** services in [Brooksville](/residential-septic-brooksville-fl/septic-system-design/), [Dade City](/residential-septic-dade-city-fl/septic-system-design/), Fort Myers, Land O’ Lakes, [Lutz](/residential-septic-lutz-fl/septic-system-design/), Miami, [Odessa](/residential-septic-odessa-fl/septic-system-design/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-system-design/), and [**Tampa**](/residential-septic-tampa-fl/septic-system-design/), Florida.* ### Similar Services We Offer: --- ### [Septic Tank Design, Lutz, FL](https://southernsepticanddesign.com/residential-septic-lutz-fl/septic-system-design/septic-tank-design/) **Published:** December 28, 2015 **Author:** Southern Water Soil **Content:** ## Let one of our knowledgeable and experienced engineers answer your questions about septic tank design in Lutz, FL. ![Septic Tank Design, Lutz, FL](/wp-content/uploads/2015/12/2012-09-14-12.08.23.jpg)Before you look anywhere else, be sure to talk to one of our experts at Southern Water and Soil about septic tank design. Having a septic tank designed and installed is a major undertaking, so you want to be sure that you hire a professional who will get the job done right without costing you an arm and a leg. When it comes to **septic tank design**, you can count on our expert engineers to see your project through from start to finish. A single call is all you need to set up an appointment for a free evaluation. One of our on-staff experts will assess your property, and then send the information along to one of our engineers to draw up the plan. Once you are satisfied with your **septic tank design**, we can connect you to one of our licensed septic tank contractors, who will oversee the installation. Whether you have a small home with a single bathroom or a commercial building with multiple bathrooms, our engineers at Southern Water and Soil have the experience and knowledge needed to custom-design your septic tank according to your needs. We offer expert-level design services and will be happy to answer all of your questions along the way. If you are thinking about having a new septic tank installed on your Lutz, FL property, make Southern Water and Soil your first [call](/contact-southern-water-and-soil/). We offer free quotes, and if you hire us for design and installation, you can rest easy knowing that we will always be just a phone call away for service and repairs, should you ever need them. --- *At Southern Water and Soil, we offer **septic tank design** services in [Tampa](/septic-services-tampa-fl/residential-septic-services/septic-tank-design/), [Odessa](/septic-services-odessa-fl/residential-septic-services/septic-tank-design/), **[Lutz](/septic-services-lutz-fl/septic-tank-design/)**, [Land O’ Lakes](/septic-services-land-olakes-fl/residential-septic-services/septic-tank-design/), [Brandon](/septic-services-brandon/residential-septic-services/septic-tank-design/), Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Find Us On The Web](https://southernsepticanddesign.com/find-us-on-the-web/) **Published:** July 13, 2023 **Author:** Southern Water Soil **Content:** Here at Southern Water and Soil, we put in a lot of work to make sure our valued customers are able to easily find us on the web through various different means. Below is a list of several different sites and directories where you can find us on the web! [1-10](#1) | [A](#A) | [B](#B) | [C](#C) | [D](#D) | [E](#E) | [F](#F) | [G](#G) | [H](#H) | [I](#I) | [J](#J) | [M](#M) | [N](#N) | [O](#O) | [R](#R) | [S](#S) | [T](#T) | [U](#U) | [W](#W) | [Y](#Y) 1-10 [2findlocal](https://www.2findlocal.com/b/9202838/southern-water-and-soil-dade-city-fl) [8coupons](https://www.8coupons.com/discounts/southern-water-and-soil-dade-city-33525) A [AppleMaps](https://maps.apple.com/place?auid=5973842093822779362) [AroundMe](http://www.yext.com/partnerpages/aroundme/southern-water-and-soil-dade-city-florida-us-5d4629) B [BestImprovers](https://www.bestimprovers.com/16288/southern-water-and-soil) [Brownbook.net](https://www.brownbook.net/business/39401282/southern-water-and-soil/) [BusinessesUp](https://www.businessesup.com/565232/southern-water-and-soil) C [CentralIndex](https://us.centralindex.com/company/695201395372032/southern-water-and-soil/dade-city) [ChamberofCommerce.com](https://www.chamberofcommerce.com/business-directory/florida/dade-city/septic-system-service/43095633-southern-water-and-soil) [CitySquares](https://citysquares.com/b/southern-water-and-soil-19865045) [ContractorsUp](https://www.contractorsup.com/346043/southern-water-and-soilpage) [Cylex](https://www.cylex.us.com/company/southern-water-and-soil-32569441.html) D [DexKnows](http://www.dexknows.com/info-498040722/s/) E [Elocal](https://www.elocal.com/profile/23049879) [EZlocal](https://ezlocal.com/fl/dade-city/septic-system-service/096402906) F [Facebook](https://www.facebook.com/southernwatersoil) G [GoLocal247](https://www.golocal247.com/biz/southern-water-and-soil/dade-city-fl/LOC714981118) H [Hotfrog](https://www.hotfrog.com/company/1099479185321984) [Hours.com](https://www.hours.com/us/Southern-Water-and-Soil/Pasadena-Hills/9852-Preakness-Stakes-Way/) I [iBegin](http://www.ibegin.com/directory/visit/19112227) [iGlobal](https://www.iglobal.co/united-states/zephyr-hills/southern-water-and-soil) J [Jackpage](https://southernsepticanddesign.wordjack.info/) M [MerchantCircle](https://www.merchantcircle.com/southern-water-and-soil-dade-city-fl) [My Local Services](https://www.mylocalservices.com/Southern+Water+and+Soil-Dade+City-Florida-24067546.html) N [Navmii](http://www.yext.com/partnerpages/navmii/southern-water-and-soil-dade-city-florida-us-5d4629) [Nextdoor](https://nextdoor.com/page/southern-water-and-soil-dade-city-fl-1/) O [Opendi](https://dade-city-fl.opendi.us/6888258.html) R [RecommendedCompany](https://www.recommendedcompany.com/info/southern-water-and-soil) S [Superpages](http://www.superpages.com/info-498040722/s/) [ShowMeLocal](https://www.showmelocal.com/profile.aspx?bid=26022492) T [Tellows](https://www.tellows.com/num/8137850500) [Top Rated Local](https://www.topratedlocal.com/southern-water-and-soil-reviews) [Tupalo](http://www.tupalo.co/valrico-florida/southern-water-and-soil) U [USCity.net](https://uscity.net/listing/southern_water_and_soil-8431945) W [Where To?](https://wheretoapp.com/search?poi=5869984688256498956) [Wogibtswas](http://wogibtswas.de/location/1254504-Southern+Water+and+Soil) Y [Yellow Pages (YP.com)](http://www.yellowpages.com/info-498040722/s/) [YellowPagesDirectory](https://www.yellowpagesdirectory.com/?page=show&state=FL&id=1691303) [Yelp](https://www.yelp.com/biz/southern-water-and-soil-dade-city?adjust_creative=MFyzcjahxBMNAyHg85HGjg&utm_campaign=yelp_api_v3&utm_medium=api_v3_business_lookup&utm_source=MFyzcjahxBMNAyHg85HGjg) --- ### [Septic System Design, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-system-design/) **Published:** June 10, 2024 **Author:** Southern Water Soil **Content:** ## Our experienced team can design an optimized septic system for your property. ![Septic System Design in Spring Hill, Florida](/wp-content/uploads/2014/07/2011-08-01-15.57.40-300x179.jpg)Our skilled team at Southern Water and Soil has over 30 years of combined experience in septic system design, and we’re equipped to tackle your residential or commercial project with ease and efficiency. If you need a new septic system design for a property in the **Spring Hill, Florida** community, we encourage you to turn to us for the high-quality service and unparalleled results that you deserve. When you contact us for help with your **septic system design**, you can expect us to provide a customized approach. Our technicians will discuss your specific needs and concerns with you before carefully assessing the property. We will make sure to consider factors such as the local topography and nearby water sources to create the optimal septic system design that will work reliably for many years to come. One key thing that makes our local business stand out from other septic companies is that our president has worked for both the Florida Department of Health and the Southwest Florida Water Management District. His past experience has given our entire team a thorough understanding of the environmental regulations and local codes that all septic systems need to meet. When you choose us to design your septic system, you can rest assured that it will be built with longevity and environmentalism in mind. Once we have completed your **septic system design**, we can also ensure that it will be properly installed by one of our vetted partners. Our team will closely oversee each aspect of the installation process to guarantee that it’s precisely placed and thoroughly tested. If you’d like to learn more about our services or schedule a consultation, please [reach out to us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic system design** services in [Brooksville](/residential-septic-brooksville-fl/septic-system-design/), [Dade City](/residential-septic-dade-city-fl/septic-system-design/), Fort Myers, Land O’ Lakes, [Lutz](/residential-septic-lutz-fl/septic-system-design/), Miami, Odessa, Orlando, Plant City, **[Spring Hill](/residential-septic-spring-hill-fl/septic-system-design/)**, and [Tampa](/residential-septic-tampa-fl/septic-system-design/), Florida.* --- ### [Septic System Design, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-system-design/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## We will design an effective septic system for your property. ![Septic System Design in Brooksville, Florida](/wp-content/uploads/2017/07/2011-08-01-15.57.40-resized.jpg)Prior to the start of every new septic install, our septic engineers and professionals at Southern Water and Soil create a proposal that includes design plans for the septic system. This design plan includes measurements for the system, information about the installation site, and other pertinent information about the overall plan for the project. Our goal during the proposal process is to create a **septic system design** that meets your needs for waste management at your property. We will also make sure that the septic system design we come up with is efficient and functional to minimize repairs and reduce maintenance requirements throughout the new system’s lifespan. For example, we will work diligently to create a design plan that reduces the likelihood of slow-moving or clogged drains. When we start a new septic system design, we draw on our 30 years of combined experience to find the best option for your property. Over the years, we have also designed systems that have specialized features, like drip irrigation. Our team works closely with the Florida Department of Health and the Florida Department of Environmental Protection. We do this so that every system we design in **Brooksville, Florida** meets all regulations and qualifies for a local permit. A custom **septic system design** is one of the best ways to ensure the ongoing functionality and efficiency of your new septic system. To start the design process, [contact us](/contact-southern-water-and-soil/) and tell us a little bit more about your property and your plans. We are excited to get to work on your project! --- *At Southern Water and Soil, we offer **septic system design** services in [**Brooksville**](/residential-septic-brooksville-fl/septic-system-design/), [Dade City](/residential-septic-dade-city-fl/septic-system-design/), Fort Myers, Land O’ Lakes, [Lutz](/residential-septic-lutz-fl/septic-system-design/), Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-system-design/), and [Tampa](/residential-septic-tampa-fl/septic-system-design/), Florida.* ### Similar Services We Offer: --- ### [Septic to Sewer Options, Florida](https://southernsepticanddesign.com/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-options/) **Published:** January 20, 2025 **Author:** Southern Water Soil **Content:** ## We can tell you about your septic to sewer options. Every property requires an effective waste management system. For some, that’s a sewer system, and for others, especially those in more rural areas, a septic system is what treats their waste. There are advantages and disadvantages to each, with one of the main disadvantages of septic systems being that they contribute excess nitrogen to groundwater. ![Septic to Sewer Options in Florida](/wp-content/uploads/2024/12/1013161020b-res.jpg) To reduce pollution and protect **Florida**’s groundwater, rivers, estuaries, and other bodies of water, the state has mandated that some specific properties convert from septic systems to a sewer system. This requirement should significantly minimize nitrogen pollution and improve water quality. It also reduces the risk of individual septic system failures, which can be more difficult to address than sewer issues. At Southern Water and Soil, we are familiar with septic to sewer conversions and can talk you through all the **septic to sewer options** available to you. For instance, one option may be a Distributed Wastewater Treatment Unit (DWTU). DWTUs are decentralized wastewater treatment solutions that are designed to fit a community’s needs and strategically placed where centralized sewer systems are too expensive or unfeasible. It’s just one of several septic to sewer options that may be possible, but we will take the time to assess your needs, present your options clearly, and execute the appropriate solution through our expert design and engineering services. [Contact us today](/contact-southern-water-and-soil/) to learn more about your **septic to sewer options** and what to expect from our team. --- *At Southern Water and Soil, we offer **septic to sewer options** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-options/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [**Florida**](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-options/).* --- ### [Septic to Sewer Options, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-options/) **Published:** December 17, 2024 **Author:** Southern Water Soil **Content:** ## We can explain your septic to sewer options in detail. Transitioning from a septic system to the public sewer system can seem like a big decision. This is why, at Southern Water and Soil, we offer a range of **septic to sewer options** designed to meet your needs and ensure the process is as smooth and efficient as possible. Whether you are looking for a permanent solution to reduce maintenance costs or you are looking for a more reliable waste management system, we have the expertise to guide you through every step of the conversion. ![Septic to Sewer Options in Dade City, Florida](/wp-content/uploads/2024/12/1013161020b-res.jpg) One of your primary septic to sewer options here in **Dade City, Florida** is connecting directly to an existing municipal sewer line. If your property is located near a sewer main, our team can facilitate the conversion by installing a new line that connects your home to the public system. This option is often the simplest and most cost-effective for homes already in close proximity to the municipal sewer. If a sewer main isn’t readily available in your area, we can help you explore alternative solutions, such as extending the existing sewer lines or working with local authorities to bring a new sewer line closer to your property. Our team will conduct a thorough site assessment to determine the best route and method for your conversion. No matter the option you choose, our team is here to help you navigate the process, ensuring a hassle-free transition from septic to sewer. For more information about your **septic to sewer options**, [reach out to us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic to sewer options** in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-options/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-options/).* --- ### [Septic to Sewer Engineering, Florida](https://southernsepticanddesign.com/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-engineering/) **Published:** January 20, 2025 **Author:** Southern Water Soil **Content:** ## Rely on our experts for septic to sewer engineering. Septic systems are incredibly useful for properties located in rural areas or any areas that are further away from municipal sewage systems. However, they may not be the ideal waste solution in every situation. ![Septic to Sewer Engineering in Florida](/wp-content/uploads/2024/12/1013161020b-res.jpg) Like any other system, septic systems have their own cons. The nitrogen coming from these systems can pollute groundwater and bodies of water, for instance. To minimize watershed pollution, the state of **Florida** has actually mandated some properties to make changes to their septic systems or convert to a sewer system entirely. You can count on our team at Southern Water and Soil for **septic to sewer engineering** and any other changes. We have three decades of experience in the septic industry and are prepared to handle all your septic engineering needs, including septic to sewer engineering. Our experts will carefully assess your property and its needs to create effective plans. We can make sure your septic system is decommissioned and your pipes are connected to the public sewer line. We understand that converting a septic system to a sewer system is not something you are familiar with in all likelihood. You can count on our team to answer your questions and ensure you understand not only why this change is needed but also how we will execute it and protect your property, as well as the environment, from harm. [Contact us today](/contact-southern-water-and-soil/) to learn more about our **septic to sewer engineering** services. --- *At Southern Water and Soil, we offer **septic to sewer engineering** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-engineering/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [**Florida**](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-engineering/).* --- ### [Septic to Sewer Engineering, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-engineering/) **Published:** December 17, 2024 **Author:** Southern Water Soil **Content:** ## We provide solutions-based septic to sewer engineering solutions. Are you looking for a reliable, long-term waste management solution? Turn to us at Southern Water and Soil. We specialize in providing **septic to sewer engineering** services, and we can convert your property from a septic system to the municipal sewer line. We know that this is a significant decision, but our engineering team is here to ensure the process is seamless, efficient, and compliant with local regulations. ![Septic to Sewer Engineering in Dade City, Florida](/wp-content/uploads/2024/12/1013161020b-res.jpg) When you hire us to take on your septic to sewer engineering project, we will begin by comprehensively evaluating your site to understand your existing infrastructure. We will work with local authorities in the **Dade City, Florida** area to confirm the availability of a sewer connection and determine the most cost-effective and practical route for connecting your home to the municipal sewer system. Our engineers consider factors like soil conditions, slope, and any potential obstacles that could affect the installation. After we have a clear understanding of your property’s needs, we will create a detailed engineering plan that outlines every step of the conversion process. This may include trenching, sewer line installation, and reconnection of your home’s plumbing to the new system. Our team will handle all the necessary permits, approvals, and inspections to make sure your conversion meets local building codes and environmental guidelines. We can answer any questions you might have about the **septic to sewer engineering** process. [Contact us today](/contact-southern-water-and-soil/) to speak with one of our septic engineering professionals! --- *At Southern Water and Soil, we offer **septic to sewer engineering** in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-engineering/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-engineering/).* --- ### [Septic to Sewer Conversion, Florida](https://southernsepticanddesign.com/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-conversion/) **Published:** January 20, 2025 **Author:** Southern Water Soil **Content:** ## We can assist with septic to sewer conversions for your property. Properties throughout **Florida** rely on septic systems to manage their waste. These systems offer treatment on site and are excellent solutions for properties in rural areas or anywhere where a public sewer system is not easily accessible. That being said, the state is making strides in its attempts to reduce watershed pollution, and the nitrogen produced by septic systems is a major contributor to this issue. As a result, your property may be required to switch from a septic system to a sewer system. Our team is here to facilitate this transition. ![Septic to Sewer Conversion in Florida](/wp-content/uploads/2024/12/1013161020b-res.jpg) At Southern Water and Soil, we have three decades of experience in the septic industry and are adept at providing exceptional design, engineering, and installation services for all kinds of properties. Our experts are familiar with the rules requiring some properties to undergo **septic to sewer conversions**, and we have the ability to handle yours. If you have been notified that you must convert to a sewer system, trust our team’s expertise throughout the design and engineering process. We will survey your property and analyze your particular needs before creating detailed plans for the changes. Count on us to decommission your septic system and reroute the pipes to the public sewer line connections carefully. Septic to sewer conversion don’t just help reduce pollution in our groundwater, fresh water, and the ocean either; they also minimize the risk of individual septic failures. Individual septic system issues can be difficult to keep under control, but a public sewer system allows for swift action to take place. [Contact us today](/contact-southern-water-and-soil/) to learn more about **septic to sewer conversions**. --- *At Southern Water and Soil, we perform **septic to sewer conversions** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-conversion/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [**Florida**](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-conversion/).* --- ### [Septic to Sewer Conversion, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-conversion/) **Published:** December 17, 2024 **Author:** Southern Water Soil **Content:** ## We can help convert your septic system to the sewer. At Southern Water and Soil, we know that maintaining a residential septic system can be a hassle over time. If you are looking for a long-term, maintenance-free solution, converting from septic to sewer might be the right choice for you. The **septic to sewer conversion** process involves disconnecting your home from its septic system and then connecting it to the public sewer line. This transition not only eliminates the need for regular septic tank pumping and repairs, but it also ensures your waste is treated and managed by your local municipality, offering you greater peace of mind. ![Septic to Sewer Conversion in Dade City, Florida](/wp-content/uploads/2024/12/1013161020b-res.jpg) We have completed countless septic to sewer conversion projects throughout the **Dade City, Florida** area. When we start your project, we will begin by completing an assessment of your property to ensure accessibility to the public sewer main. Our team will handle all the permits and paperwork necessary to ensure the conversion is compliant with local regulations. The work will usually include digging a trench, laying the sewer line, and then reconnecting your home to the new system. We will take care of everything, ensuring minimal disruption to your daily life. In many cases, we recommend switching to the sewer system because this can increase the value of your property, as it removes the liability and potential concerns associated with septic systems. If you are ready to move forward with the **septic to sewer conversion** process, we are ready and waiting to get started. For more information, [reach out to us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we perform **septic to sewer conversions** in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-conversion/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/septic-to-sewer-conversion/).* --- ### [Septic to Sewer Commercial Corridors Program, Florida](https://southernsepticanddesign.com/residential-septic-florida/septic-to-sewer-commercial-corridors-program/) **Published:** August 21, 2023 **Author:** Southern Water Soil **Content:** ## Let us help you transition from septic to sewer. Our team at Southern Water and Soil has the expertise and skill needed to help you transition from a septic to a sewer system with the **Septic to Sewer Commercial Corridors Program** in **Florida**. We’ve worked hand in hand on several projects within the program and can handle your conversion with minimal disruption to you. Keep reading to learn what benefits you can gain from transitioning from septic to sewer. ![Septic to Sewer Commercial Corridors Program in Florida](/wp-content/uploads/2023/05/2014-01-11-00.12.54-resized.jpg) - **Convenience and Upkeep.** One of the best things about transitioning to a public sewer system is that you don’t have to do as much upkeep. Septic systems must be pumped and maintained, which can take time and cost money. On the other hand, a sewer system is run and kept by the local government. This means you don’t have to worry about routine maintenance. - **Environmentally Friendly.** Sewer systems are made to clean and process wastewater in a way that doesn’t pollute or pollute the groundwater. Participating in the Septic to Sewer Commercial Corridors Program, you help protect the local environment and water quality, aligning with current environmental laws and standards. - **Increased Tenant Interest.** A property linked to a public sewer system is often seen as more desirable by tenants. This is essential if you own your building and lease it to companies. - **Scalability and Growth.** Compared to individual septic systems, sewer systems can handle heavier use. This scalability can be significant for business properties that want to grow, change, or switch tenants. With a sewer link, you can grow without worrying about the system’s capacity. The **Septic to Sewer Commercial Corridors Program** is an important community initiative we proudly support. To learn more about this program and your eligibility, [give our team a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we can assist with the **Septic to Sewer Commercial Corridors Program** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/), Fort Myers, Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-to-sewer-commercial-corridors-program/), Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [**Florida**](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/).* ### Similar Services We Offer: --- ### [Septic to Sewer Commercial Corridors Program, Miami, FL](https://southernsepticanddesign.com/residential-septic-miami-fl/septic-to-sewer-commercial-corridors-program/) **Published:** May 28, 2023 **Author:** Southern Water Soil **Content:** ## Join us in building a sustainable future. **Miami, Florida**, a city steeped in rich cultural diversity and dynamic growth, grapples with the evolving task of effective and sustainable wastewater management. We are tackling this challenge at Southern Water and Soil, and we want to tell you about the innovative **Septic to Sewer Commercial Corridors Program**. ![Septic to Sewer Commercial Corridors Program in Miami, Florida](/wp-content/uploads/2023/05/2014-01-11-00.12.54-resized.jpg) While septic systems offer certain advantages, they can present difficulties in densely populated commercial zones, where escalating maintenance costs and the risk of groundwater contamination are concerns. By adopting public sewer systems, commercial properties gain a more dependable, eco-friendly, and enduring solution to their wastewater needs. The **Septic to Sewer Commercial Corridors Program** is designed to help commercial properties gain better waste management solutions. This well-orchestrated initiative aims to connect over 1,000 commercial properties to public sewers, significantly reducing the dependency on onsite septic systems. This transformative initiative curtails maintenance costs for property owners and minimizes the potential for groundwater contamination, contributing to a healthier and safer environment for the entire community. We are fully invested in every facet of this transition—from the preliminary stages of planning and design to the final installation and subsequent maintenance. Our industry knowledge, vast experience, and unwavering commitment ensure a smooth conversion process, minimizing potential disruption to your business operations. Join us in building a sustainable future with the Septic to Sewer Commercial Corridors Program as we redefine wastewater management for the betterment of our community. Make the switch to sewer systems and take a significant step towards contributing to a healthier environment. [Contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we can assist with the **Septic to Sewer Commercial Corridors Program** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/), Fort Myers, Land O’ Lakes, Lutz, **[Miami](/residential-septic-miami-fl/septic-to-sewer-commercial-corridors-program/)**, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/).* --- ### [Septic to Sewer Commercial Corridors Program, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/) **Published:** May 28, 2023 **Author:** Southern Water Soil **Content:** ## We have the technical knowledge to execute the conversion from septic system to sewer. Southern Water and Soil is a proud participant in the **Septic to Sewer Commercial Corridors Program**. This program helps **Dade City, Florida** commercial properties convert from septic systems to public sewer systems to improve wastewater management and reduce environmental impact. ![Septic to Sewer Commercial Corridors Program in Dade City, Florida](/wp-content/uploads/2023/05/2014-01-11-00.12.54-resized.jpg) Our team handles large-scale conversions, ensuring minimal disruption to your business operations. We have the technical knowledge and hands-on experience to execute these conversions efficiently, meeting all regulatory requirements. The **Septic to Sewer Commercial Corridors Program** is an important initiative, as it promotes a more sustainable and environmentally responsible approach to wastewater management. By converting to public sewer systems, commercial properties can significantly reduce the risk of groundwater contamination, prevent septic system failures, and contribute to a cleaner environment for the entire community. Through the Septic to Sewer Commercial Corridors program, the county prioritizes which parcels will convert from septic to sewer connections based on factors such as possibility of septic failure and other ranking criteria. Properties that already have access to existing sewer infrastructure are more likely to qualify for the program. From there, the work will shift to expanding the county’s sanitary sewer system and connecting properties with septic systems based on their level of risk. We recognize the challenges businesses face when transitioning from septic to sewer systems. That’s why we provide comprehensive support throughout the process, from obtaining permits and coordinating with local authorities to ensuring the new sewer connection is seamlessly integrated into your existing infrastructure. [Contact us today](/contact-southern-water-and-soil/) to talk to our team of experts who deliver impeccable results through our proven processes. --- *At Southern Water and Soil, we can assist with the **Septic to Sewer Commercial Corridors Program** in Brooksville, **[Dade City](/residential-septic-dade-city-fl/septic-to-sewer-commercial-corridors-program/)**, Fort Myers, Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-to-sewer-commercial-corridors-program/), Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/septic-to-sewer-commercial-corridors-program/).* ### Similar Services We Offer: --- ### [Septic System Replacements, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-systems/septic-system-replacements/) **Published:** September 1, 2024 **Author:** Southern Water Soil **Content:** ## Count on us to precisely replace your old septic system. If you have a private septic system on your residential or commercial property, you probably know how important it is to get your tank pumped regularly and schedule ongoing maintenance services. However, no matter how well you maintain your septic system, no material is designed to last forever. Eventually, you’ll need to begin looking into **septic system replacements** to keep your property safe, convenient, and hygienic. ![Septic System Replacements in Tampa, Florida](/wp-content/uploads/2023/12/2012-11-20-12.45.25-res.jpg) Fortunately, if you’re located in the **Tampa, Florida** community, you don’t need to look far to find a reliable team to handle your septic system replacement project. Here at Southern Water and Soil, our skilled septic professionals have over 30 years of industry experience, and we’re thoroughly equipped to tackle your septic system replacement needs with excellence. If you choose to contact us about **septic system replacements**, we’ll be more than happy to set up a consultation with you at your earliest convenience. During this initial meeting, we’ll conduct a thorough inspection of your current septic system, taking careful notes of any areas of concern. We will also assess your property and local surroundings to begin thinking about the optimal layout for your upgraded system. Once we’ve gathered all the information we need, we’ll be able to give you a quote for our replacement services. We’ll answer any questions you may have, and we can tell you more about nitrogen-reducing septic system replacements, if that’s something you’re interested in. If you approve of our estimate and plan, we’ll get started as soon as possible. Additionally, while we’ll be overseeing permitting, design, engineering and any considerations for potential BMAP planning, the installation process will be constructed by one of our carefully vetted partners. To learn more about septic system replacements or schedule a consultation, please [contact us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we provide **septic system replacements** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-systems/septic-system-replacements/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-systems/septic-system-replacements/), and [**Tampa**](/residential-septic-tampa-fl/septic-systems/septic-system-replacements/), Florida.* --- ### [Septic System Replacements, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-systems/septic-system-replacements/) **Published:** June 10, 2024 **Author:** Southern Water Soil **Content:** ## We’re equipped to replace your residential or commercial septic system. At Southern Water and Soil, our experienced professionals know that even the most well-maintained septic systems will eventually wear out and need to be replaced. That’s why we offer high-quality septic system replacements throughout the **Spring Hill, Florida** area. Our skilled technicians are equipped to design both residential and commercial systems, and we’re prepared to upgrade your current system with a more efficient and reliable model. ![Septic System Replacements in Spring Hill, Florida](/wp-content/uploads/2023/12/2012-11-20-12.45.25-res.jpg) If you’re in need of **septic system replacements**, we strongly encourage you to reach out to our team. We can ensure a seamless experience by taking care of every aspect of the replacement process, from assessing your property to designing a customized system plan to testing the final installation. We would also be happy to tell you about septic system replacements that we have completed in the past. Although our staff members manage and oversee the permitting, designing, engineering, and other Basin Management Action Plan (BMAP) considerations, the actual installation process will be handled by one of our carefully vetted partners to guarantee exceptional results. We can tell you more about this collaborative process during our initial consultation with you. Before any **septic system replacements** can occur, our team will need to carefully examine and inspect the current system and property. If the current system is old or failing, we will work efficiently to design a more effective system that will reliably provide the functionality your property requires. We will ensure that the new design complies with all applicable codes and regulations before contacting one of our partners to handle the removal and installation process. Once this step is complete, we’ll thoroughly test the system to give you ultimate peace of mind. If you’d like to learn more about septic system replacements or schedule a consultation with one of our team members, please [reach out to us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we provide **septic system replacements** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-systems/septic-system-replacements/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, **[Spring Hill](/residential-septic-spring-hill-fl/septic-systems/septic-system-replacements/)**, and [Tampa](/residential-septic-tampa-fl/septic-systems/septic-system-replacements/), Florida.* --- ### [Septic System Replacements, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-systems/septic-system-replacements/) **Published:** October 19, 2023 **Author:** Southern Water Soil **Content:** ## We’re proud to offer high-quality septic system replacements. **Septic system replacements** are often necessary when an existing system becomes too old, fails to work properly, or puts the environment or people’s health at risk. While the septic system replacement process can sound intimidating or overwhelming, our team at Southern Water and Soil is here to ensure the project goes smoothly. ![Septic System Replacements in Dade City, Florida](/wp-content/uploads/2023/10/2012-11-20-12.45.25-res.jpg) We have over 30 years of combined industry experience, and we’re proud to serve the community of **Dade City, Florida**. We’re committed to helping homeowners with a broad range of septic problems, including everything from inspections to septic system replacements. If you choose us to manage your replacement job, you can have confidence in our skills, expertise, and knowledge of local codes and regulations. Whenever we begin septic system replacements, our team starts by assessing the condition of the current system, as well as the property itself. Factors such as the number of people in your household and the soil type will be used to create an optimal design for your upgraded system. While we’ll be overseeing the permitting, designing, engineering, and any other BMAP (Basin Management Action Plan) considerations, the installation process will be completed by one of our carefully vetted partners. They will carefully remove all the components of your old septic system, construct the new design, and replace the system with a more efficient model. We’ll make sure to thoroughly inspect and test your new system to give you the peace of mind that you and your family deserve. If you have any questions or concerns about **septic system replacements**, please don’t hesitate to [reach out to us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we provide **septic system replacements** in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/septic-systems/septic-system-replacements/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-systems/septic-system-replacements/), and [Tampa](/residential-septic-tampa-fl/septic-systems/septic-system-replacements/), Florida.* --- ### [Septic System Installations, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-systems/septic-system-installations/) **Published:** September 1, 2024 **Author:** Southern Water Soil **Content:** ## We can expertly handle your septic systems installation project. If you’re planning to build a home or a commercial facility in the **Tampa, Florida** area, you can either have a private septic system installed or connect to the municipal water supply. If it makes more sense to have your own septic system on your property, our team at Southern Water and Soil can help with each step of the installation process. ![Septic System Installations in Tampa, Florida](/wp-content/uploads/2024/06/IMAG1003-res.jpg) For over 30 years, our skilled contractors have been providing comprehensive septic services throughout our community, ranging from **septic system installations** to upgrades and everything in between. We are equipped to tackle both commercial and residential projects with efficiency and precision, and we’d be thrilled to tell you more about how we approach **septic system installations**. Before we can begin designing a tailored septic system for a client, we’ll need to carefully evaluate the property. We will consider factors such as elevation changes, local water sources, average building capacity, and other key details to understand your precise needs. Once we have all the information we need, we can begin designing a custom septic system layout and determine where each component should be placed. We’ll give you a precise quote for our services, and if you approve of our plan, we’ll begin planning for the installation process right away. Septic system installations can be disruptive and time-consuming, so it’s vital for property owners to rely on a knowledgeable team that will be able to complete the job with efficiency and excellence. Additionally, while we’ll be overseeing permitting, design, engineering and any considerations for potential BMAP planning, the installation process will be constructed by one of our carefully vetted partners. To ensure that your septic system is designed and installed for long-term reliability, we invite you to [reach out](/contact-southern-water-and-soil/) to our team today. --- *At Southern Water and Soil, we provide **septic system installations** in [Brooksville](/residential-septic-brooksville-fl/septic-systems/septic-system-installations/), [Dade City](/residential-septic-dade-city-fl/septic-systems/septic-system-installations/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-systems/septic-system-installations/), and **[Tampa](/residential-septic-tampa-fl/septic-systems/septic-system-installations/)**, Florida.* --- ### [Septic System Installations, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-systems/septic-system-installations/) **Published:** June 10, 2024 **Author:** Southern Water Soil **Content:** ## Rely on our meticulous team to get your new septic system up and running. Septic system installations can be overwhelming, complicated, and time-consuming — when you hire the wrong team. However, when you choose our experienced professionals here at Southern Water and Soil for **septic system installations**, you can expect a smooth, streamlined, and customized process that will have your new system up and running in no time. Our team members have over 30 years of combined industry experience, and we’re ready to put our knowledge to work for you. ![Septic System Installations in Spring Hill, Florida](/wp-content/uploads/2024/06/IMAG1003-res.jpg) We are proud to serve clients throughout the **Spring Hill, Florida** area, and we are equipped to offer septic system installations for residential and commercial properties alike. Although we thoroughly oversee each aspect of the septic system design and installation process, from permitting to engineering and other Basin Management Action Plan (BMAP) consideration, it should be noted that the actual septic system installations are always handled by one of our highly trusted and vetted partners. This collaborative approach ensures that our professional design is followed precisely and placed according to your property’s exact needs. Before we tackle any **septic system installations**, we’ll always set up a consultation and site evaluation with our clients. We will make sure to thoroughly examine the property before creating a custom design for the new septic system. Once the design is finalized and approved by the client, we will contact our vetted partner to handle the installation process. We’ll oversee the entire project and ensure that the system is thoroughly tested to guarantee long-term reliability. If you would like to learn more about septic system installations, please [reach out to our team today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we provide **septic system installations** in [Brooksville](/residential-septic-brooksville-fl/septic-systems/septic-system-installations/), [Dade City](/residential-septic-dade-city-fl/septic-systems/septic-system-installations/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, **[Spring Hill](/residential-septic-spring-hill-fl/septic-systems/septic-system-installations/)**, and [Tampa](/residential-septic-tampa-fl/septic-systems/septic-system-installations/), Florida.* --- ### [Septic System Installations, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-systems/septic-system-installations/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## You can count on us to ensure that your new system is expertly installed. For homes that don’t have centralized sewer systems, a septic system is required to eliminate sewage and wastewater. Ensuring smooth and effective **septic system installations** takes a team dedicated to the homeowner’s needs with experienced partners working on their side. If you’re a homeowner curious about septic system installations, we’re the team you need. At Southern Water and Soil, we have years of experience providing the support and care required for many septic system tasks, and we have a strong team of vetted partners who can provide you with the installation services you need. ![Septic System Installations in Brooksville, Florida](/wp-content/uploads/2023/10/IMAG1003-res.jpg) For the safety of the environment and your health, septic system sites must follow all local, state, and national rules. Our team knows these rules inside and out, so we can quickly get the necessary permits and approvals so that your project continues moving forward. We will also create a detailed septic system design plan that takes several factors into consideration, like the optimal tank location, the type of soil, the level of groundwater, and the layout of the land. Finally, while we’ll be overseeing permitting, design, engineering, and any considerations for potential BMAP planning, the installation process will be constructed by one of our carefully vetted partners. We work closely with these partners to ensure they offer thorough and proper septic system installations that follow the plan and provide you with peace of mind that your septic system will work as it should. **Septic system installations** can be a difficult job, which is why you need an experienced team to ensure the details are met. [Contact our team](/contact-southern-water-and-soil/) today to learn more about the services we offer in the **Brooksville, Florida** area. --- *At Southern Water and Soil, we provide **septic system installations** in [**Brooksville**](/residential-septic-brooksville-fl/septic-systems/septic-system-installations/), [Dade City](/residential-septic-dade-city-fl/septic-systems/septic-system-installations/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-systems/septic-system-installations/), and [Tampa](/residential-septic-tampa-fl/septic-systems/septic-system-installations/), Florida.* --- ### [Septic System Installations, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-systems/septic-system-installations/) **Published:** October 19, 2023 **Author:** Southern Water Soil **Content:** ## Count on our experienced team for your septic system installation project. When it comes to something as important as your home’s septic system, you can’t afford to choose the wrong company. **Septic system installations** can be complex and time-consuming projects, and the last thing you want is to deal with the lasting effects of low-quality work. ![Septic System Installations in Dade City, Florida](/wp-content/uploads/2023/10/IMAG1003-res.jpg) If you’re located in the **Dade City, Florida** area, you don’t have to look far for a reliable team. At Southern Water and Soil, our highly skilled technicians have over 30 years of combined industry experience, and we have completed countless septic system installations. Our meticulous process and dedication to exceptional workmanship ensure that your new septic system will be well-designed and functional for many years to come. If you reach out to our team, we’ll begin by thoroughly assessing your property. Once we’ve determined where your septic system can be installed, we will get to work on designing a custom plan for your property and its specific soil type. After creating a design and obtaining all the relevant permits, we can get to work on the actual installation process. While we’ll be overseeing the permitting, designing, engineering, and any other BMAP (Basin Management Action Plan) considerations, the installation process will be managed by one of our carefully vetted partners. After the septic system installation project is complete, we’ll make sure to test it and complete a final inspection to ensure that everything is functioning properly. If you would like to know more about our experience with **septic system installations** or schedule an appointment, please [contact our team](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we provide **septic system installations** in [Brooksville](/residential-septic-brooksville-fl/septic-systems/septic-system-installations/), [**Dade City**](/residential-septic-dade-city-fl/septic-systems/septic-system-installations/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-systems/septic-system-installations/), and [Tampa](/residential-septic-tampa-fl/septic-systems/septic-system-installations/), Florida.* --- ### [Septic Systems, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-systems/) **Published:** August 1, 2024 **Author:** Southern Water Soil **Content:** ## It’s important to ensure your septic system is working as it should in the Tampa area. It is critical to keep your property’s septic system in good working order, and partnering with a reliable team can help you accomplish this. Regardless of the septic services you need in the **Tampa, Florida** area, whether they be installations, replacements, or something else, relying on the right team can make all the difference. For instance, our team at Southern Water and Soil has more than 30 years of combined experience in the industry and attention to detail that’s hard to find anywhere else. ![Septic Systems in Tampa, Florida](/wp-content/uploads/2019/09/2012-01-26-14.54.33-feat.jpg) We understand the complexity of **septic systems** and can appropriately evaluate your requirements. From soil testing to system design, we ensure that every step is carried out appropriately, preventing any problems down the road. We also take great care to ensure proper installation, which is essential for longevity and efficiency. In addition, we use the latest tools and techniques, along with high-quality materials, giving you peace of mind that your system will work as needed. Beyond these things, we’re customer-focused, ensuring we take the time to fully explain our process and answer any questions our customers might have about **septic systems**. For us, it’s important that you have the knowledge needed to feel confident about your system and feel comfortable reaching out when you need help. You’ll also find that we offer clear communication and professionalism every step of the way. Septic systems are an important part of many properties in the Tampa area, and ensuring they’re functioning as they should is key. [Contact](/contact-southern-water-and-soil/) our team today to assess the condition of your system. --- *At Southern Water and Soil, we install **septic systems** in [Brooksville](/residential-septic-brooksville-fl/septic-systems/), [Dade City](/residential-septic-dade-city-fl/septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-systems/), and **[Tampa](/residential-septic-tampa-fl/septic-systems/)**, Florida.* ### Similar Services We Offer: --- ### [Septic Systems, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-systems/) **Published:** June 10, 2024 **Author:** Southern Water Soil **Content:** ## Count on us for comprehensive septic system services. When it comes to septic systems here in the **Spring Hill, Florida** area, there’s no better place to turn than our local business at Southern Water and Soil. Our experienced and knowledgeable team has over three decades of combined industry experience, and we offer a comprehensive range of services to keep residential and commercial septic systems in excellent condition. Whether you need a replacement, a repair, an installation, or maintenance, our professionals can handle your needs with precision, professionalism, and efficiency. ![Septic Systems in Spring Hill, Florida](/wp-content/uploads/2019/09/2012-01-26-14.54.33-feat.jpg) When you contact us for help with **septic systems**, we’ll always begin with a thorough consultation and inspection. If you are experiencing issues with your current system, we’ll diagnose the root cause of the issue, determine the most effective solution, and share our recommendations with you. If you are thinking about upgrading your system or installing a new one, we can offer expert septic system design services to ensure optimal functionality. We can also provide ongoing maintenance for all types of septic systems to keep them working as expected. We understand that there are several businesses in the local area that offer services for **septic systems**, but we strive to stand out from the competition in several key ways. For instance, we always offer a customer-first approach, no matter how large or small the project may be. Our top priority is our customers’ satisfaction, and we’re willing to go the extra mile to ensure that they’re happy with our services. Our highly experienced professionals also offer unparalleled knowledge and expertise, making us a trustworthy resource for all types of property owners throughout the community. If you need assistance with septic systems on any of your residential or commercial properties, we encourage you to [contact us](/contact-southern-water-and-soil/) for the prompt and attentive service you need. --- *At Southern Water and Soil, we install **septic systems** in [Brooksville](/residential-septic-brooksville-fl/septic-systems/), [Dade City](/residential-septic-dade-city-fl/septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, **[Spring Hill](/residential-septic-spring-hill-fl/septic-systems/)**, and [Tampa](/residential-septic-tampa-fl/septic-systems/), Florida.* ### Similar Services We Offer: --- ### [Septic Systems, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-systems/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## If it involves your septic system, you can count on us. At Southern Water and Soil, we have been in the septic industry near **Brooksville, Florida** for over three decades. We have experience with all types of **septic systems**, from simple residential ones to complex commercial and industrial systems. We also have knowledge of and experience with newer types of septic systems, like nitrogen-reducing septic options that are more environmentally friendly. ![Septic Systems in Brooksville, Florida](/wp-content/uploads/2019/09/2012-01-26-14.54.33-feat.jpg) When it comes to septic systems, we do it all: - **Installations:** The best way to protect your investment in your new septic system is to ensure that it is designed and installed correctly from the beginning. Doing it right the first time is the most cost-effective approach, and we pride ourselves on delivering quality septic systems with minimal headaches. - **Maintenance:** Regular pump-outs and inspections are the best way to ensure optimal performance and maximum longevity for your septic system once it is installed. Regular maintenance allows us to find small problems and repair them before major issues arise. - **Repairs:** Whether you need small repairs or need us to fix larger problems, you can be sure that we will do our best to bring you the best solution in a cost-effective way. - **Replacements:** Nothing lasts forever, and that is true for **septic systems** as well. Eventually, it may be more cost-effective to replace your septic system than to keep repairing it. We will give you forthright information about your septic system and educate you so that you can make the best decision for your needs and budget. If it involves your septic system, you can count on us. [Give us a call](/contact-southern-water-and-soil/) now and let us know how we can help. --- *At Southern Water and Soil, we install **septic systems** in [**Brooksville**](/residential-septic-brooksville-fl/septic-systems/), [Dade City](/residential-septic-dade-city-fl/septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-systems/), and [Tampa](/residential-septic-tampa-fl/septic-systems/), Florida.* ### Similar Services We Offer: --- ### [Septic Systems, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-systems/) **Published:** May 29, 2023 **Author:** Southern Water Soil **Content:** ## A septic system isn’t just a part of a property; it’s a lifeline. For more than three decades, Southern Water and Soil has been an anchor in the **Dade City, Florida** community, providing a comprehensive suite of **septic systems** that residents and businesses have come to trust and rely upon. From the humble abode of a single-family home to the bustling hub of multi-tenant commercial properties, we’ve seen it all, and we’ve met every challenge with expertise, innovation, and an unwavering commitment to quality. ![The first thing to consider when you are looking at drain field options is size](/wp-content/uploads/2019/09/2012-01-26-14.54.33-feat.jpg) Our role in the community is crucial. Why? Because a septic system isn’t just a part of a property; it’s a lifeline. It’s an unsung hero that quietly and efficiently treats and disposes of wastewater, keeping your home or business running smoothly. When it’s designed and maintained with expertise and diligence, **septic systems** can provide decades of reliable service. We have a straightforward philosophy: do it right the first time. This mantra drives everything we do. We blend the latest technology with our in-depth understanding of local soil conditions, regulations, and design principles to create septic systems that are tailored to meet the unique needs of each client and property. But our job doesn’t end once a system is installed. We believe in forging long-term relationships with our clients, offering regular maintenance services and swift, efficient repairs to ensure your system operates at peak performance. We’re not just your service providers; we’re your partners, always ready to educate you about your system and the crucial role regular maintenance plays in its longevity. Innovation is at the heart of our operations. We specialize in environmentally friendly solutions, such as nitrogen-reducing systems and conversions from septic to sewer systems. We’re committed not just to serving our clients but also to protecting Florida’s precious water resources and helping our clients reduce their environmental footprint. We take pride in our hard-earned reputation for quality, reliability, and unmatched customer service. But we’re not resting on our laurels; we’re continually striving to exceed expectations and set new standards in our industry. So, whether you need a new septic system or need to maintain an existing one, we’re here to serve you with professionalism and dedication. --- *At Southern Water and Soil, we install **septic systems** in [Brooksville](/residential-septic-brooksville-fl/septic-systems/), **[Dade City](/residential-septic-dade-city-fl/septic-systems/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-systems/), and [Tampa](/residential-septic-tampa-fl/septic-systems/), Florida.* ### Similar Services We Offer: --- ### [Septic System Repair, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-system-repair/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## When your septic system needs professional services, we are ready to go. You can’t ignore a faulty or damaged septic system. Septic issues can cause serious damage to your property, not to mention the health hazards associated with septic leaks that can make you and your family sick. While proper maintenance services can help extend the lifespan of your system and prevent large issues from occurring, you’ll still likely need **septic system repair** services at some point, especially if your system is older. ![Septic System Repair in Tampa, Florida](/wp-content/uploads/2023/09/2011-03-17-17.29-res.jpg) Septic system repair refers to any services designed to restore your septic system to proper working condition once it begins to struggle or break down. Be on the lookout for any signs that your system needs professional repair services, such as odors around the tank or gurgling sounds in and around your home’s plumbing system. The longer you ignore these issues, the more likely damages are to worsen and cause further issues for your system. When your **Tampa, Florida** septic system is struggling to do its job properly, we here at Southern Water and Soil are ready to help you out. Our **septic system repair** services are backed by our years in the septic system industry, and we are fully equipped to address any needs that your system has. From clogs in the tank to issues with your drain field, no septic problems are too big for our team of qualified professionals to tackle. You deserve to work with a septic repair company that you can trust, so [give our team a call](/contact-southern-water-and-soil/) today if you’re worried about your home’s septic system. --- *At Southern Water and Soil, we offer **septic system** repair services in [Brooksville](/residential-septic-brooksville-fl/septic-system-repair/), [Dade City](/residential-septic-dade-city-fl/septic-system-repair/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-system-repair/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-system-repair/), and [**Tampa**](/residential-septic-tampa-fl/septic-system-repair/), Florida.* --- ### [Septic System Repair, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-system-repair/) **Published:** September 8, 2023 **Author:** Southern Water Soil **Content:** ## We can fix your septic system in no time. Lately, you’ve noticed that your septic system just isn’t processing wastewater like it used to. Maybe your drains run slower than normal or you’re seeing water back up into your sinks and toilets. Or maybe, you notice puddles of standing water in your yard, or the area around your septic tank gives off foul odors that make you want to run back in your house. ![Septic System Repair in Dade City, Florida](/wp-content/uploads/2023/09/2011-03-17-17.29-res.jpg) If any of this sounds familiar, the first thing you need to do is call us at Southern Water and Soil for **septic system repair** services. We’re a trusted source for all things septic, including septic system repair work, in the **Spring Hill, Florida** area, and we won’t waste any time fixing your malfunctioning system. We know it’s hard to live in a house that has a septic system that isn’t working, so we’ll do our best to diagnose and rectify the issue as quickly as possible. Once you call, we’ll book a time for one of our septic professionals to come and assess the problem. After we know what’s going on, we’ll start the repair and make sure it takes care of the issue. Along the way, don’t hesitate to ask us any questions you have about why we’re doing what we’re doing or what you can expect during the repair. We make the septic system repair process quick, easy, and efficient, so you can go back to not worrying about your septic system. To schedule a **septic system repair** appointment or learn more about our services, [contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic system** repair services in [Brooksville](/residential-septic-brooksville-fl/septic-system-repair/), [Dade City](/residential-septic-dade-city-fl/septic-system-repair/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-system-repair/), Orlando, Plant City, Wesley Chapel, **[Spring Hill](/residential-septic-spring-hill-fl/septic-system-repair/)**, and [Tampa](/residential-septic-tampa-fl/septic-system-repair/), Florida.* --- ### [Septic System Repair, Odessa, FL](https://southernsepticanddesign.com/residential-septic-odessa-fl/septic-system-repair/) **Published:** September 8, 2023 **Author:** Southern Water Soil **Content:** ## Count on us to fix your septic system fast. There’s nothing worse than a septic system that has started to malfunction. Not only may you be dealing with backups in your sinks and toilets, but you may also wonder if your septic system has major damage. Whether your system needs a minor fix or is heading towards a total replacement, you have nothing to worry about with our team at Southern Water and Soil on your side. ![Septic System Repair in Odessa, Florida](/wp-content/uploads/2023/09/2011-03-17-17.29-res.jpg) We’re septic system repair professionals in the **Odessa, Florida** area, and we can take care of any repair project you throw our way. Here are just a few reasons to hire us for your next septic system repair: - Nothing gets past us! We’ll identify any and all problems with your septic system and fix them, so you have a system that functions properly and efficiently once more. - We have years of experience performing **septic system repair** work. When you hire us, you can rest easy knowing we’ll take care of the issue with excellence. - We’re committed to providing excellent septic services and customer service. We’ll go the extra mile to make sure you feel confident and informed when working with our team. The next time you need **septic system repair** work done, [contact our team](/contact-southern-water-and-soil/) of experts. We’ll respond to your request for repairs quickly, answer any questions you might have, quote you fairly, and do whatever it takes to ensure your satisfaction. --- *At Southern Water and Soil, we offer **septic system** repair services in [Brooksville](/residential-septic-brooksville-fl/septic-system-repair/), [Dade City](/residential-septic-dade-city-fl/septic-system-repair/), Fort Myers, Land O’ Lakes, Lutz, Miami, **[Odessa](/residential-septic-odessa-fl/septic-system-repair/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-system-repair/), and [Tampa](/residential-septic-tampa-fl/septic-system-repair/), Florida.* --- ### [Septic System Repair, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-system-repair/) **Published:** September 8, 2023 **Author:** Southern Water Soil **Content:** ## Call us the next time your septic system fails. When your septic system is working like it should, you probably don’t give it much thought. But when something goes wrong with your septic system, the problem is hard to ignore, especially since it can affect your ability to keep living like you normally do in your **Brooksville, Florida** home. Suddenly, doing the dishes, running the washing machine, using your sinks and toilets, and using any appliance that requires water becomes nearly impossible. ![Septic System Repair in Brooksville City, Florida](/wp-content/uploads/2023/09/2011-03-17-17.29-res.jpg) Luckily, you can call us at Southern Water and Soil the next time you need **septic system repair** solutions. We proudly serve homeowners throughout the Brookville, Florida area, and we’re known for our prompt, effective, and personal septic system repair services. What are some signs that you need septic system repair? Call us the next time you notice any of these indicators that your septic system is struggling: - - Water or sewage keeps backing up into your sinks, toilets, showers, and tubs. - Your bathtubs, sinks, and showers drain slowly. - You hear gurgling sounds coming from your plumbing system. - You notice standing water or damp spots around your septic tank or drain field. - The area around your septic tank gives off unpleasant odors. When you [call us](/contact-southern-water-and-soil/) for **septic system repair**, we’ll respond quickly to your request, so you can have a functioning septic system again as quickly as possible. The next time you need someone to come and fix your septic system, remember that our experienced professionals are always just a quick phone call away. --- *At Southern Water and Soil, we offer **septic system** repair services in **[Brooksville](/residential-septic-brooksville-fl/septic-system-repair/)**, [Dade City](/residential-septic-dade-city-fl/septic-system-repair/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-system-repair/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-system-repair/), and [Tampa](/residential-septic-tampa-fl/septic-system-repair/), Florida.* --- ### [Septic System Repair, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-system-repair/) **Published:** September 8, 2023 **Author:** Southern Water Soil **Content:** ## Hire us to fix your septic system. A working septic system is a necessity to keep living in your home. If your septic system starts to malfunction in any way, it can create problems for you and the other people living with you. The good news is that when you need to get your septic system fixed, and you need it fixed fast, you can count on us at Southern Water and Soil for excellent solutions and prompt service. ![Septic System Repair in Dade City, Florida](/wp-content/uploads/2023/09/2011-03-17-17.29-res.jpg) Some of the signs you should call us for **septic system repair** include toilets that back up when you flush, odd smells coming from the area around your septic system, puddles in your grass, and problems with your sinks draining. All of these signs could indicate that you need to pump out your septic system, a process that removes the buildup of solid waste from the bottom of your tank. If a septic pump-out won’t solve the problem, our septic system repair experts are ready to put their knowledge and expertise to good use. We’ll figure out exactly what went wrong with your system and employ solutions that get it back up and running again. You can count on us to find the problem right away and recommend long-term solutions, not quick fixes, to the issue at hand. If you’re looking for a septic system repair professional in the **Dade City, Florida** area you can count on, you can’t go wrong working with us. To get a quote for septic system repair or book an appointment with us, [contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic system** repair services in [Brooksville](/residential-septic-brooksville-fl/septic-system-repair/), **[Dade City](/residential-septic-dade-city-fl/septic-system-repair/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-system-repair/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-system-repair/), and [Tampa](/residential-septic-tampa-fl/septic-system-repair/), Florida.* --- ### [Septic Tank Design, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-system-design/septic-tank-design/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## You can count on our experts to design the optimal septic tank for your property. ![Septic Tank Design in Tampa, Florida](/wp-content/uploads/2016/08/2012-01-26-13.06.02_resized.jpg)Septic waste management is essential for public health. These systems are designed to prevent dangerous bacteria from sewage from entering the groundwater, which in turn keeps people from getting sick. Our team at Southern Water and Soil has extensive experience in the septic industry, and we can help you with all your waste management needs. For example, we provide **septic tank design** services to help you get the best results from your new septic system. When we start work on a **septic tank design** project, we consider factors such as the size of the property and how many people it serves. For example, a septic tank for a single-family home will be smaller than one meant to serve a large office complex. We also consider factors such as local regulations, as the requirements for wastewater management can vary significantly from place to place. Additional factors affecting septic tank design include the topography of the land and the composition of the soil, as both will impact how effluent flows. Our team has the right experience to take this information and use it to design the optimal septic system for your property. Our team is proud to serve the community here in **Tampa, Florida**, and we want to help you find the best solutions for your septic needs. If you need a new septic system for your business, development, or other property, we encourage you to [give us a call](/contact-southern-water-and-soil/) at your earliest convenience to get our septic tank design experts on the job. --- *At Southern Water and Soil, we offer **septic tank design** services in [Brooksville](/residential-septic-brooksville-fl/septic-system-design/septic-tank-design/), [Dade City](/residential-septic-dade-city-fl/septic-system-design/septic-tank-design/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-services-odessa-fl/septic-tank-design/), Orlando, Plant City, Spring Hill, and **[Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/septic-tank-design/)**, Florida.* --- ### [Time Dose Control Box, Dade City, Fl](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/time-dose-control-box/) **Published:** March 27, 2024 **Author:** Southern Water Soil **Content:** ## Put your septic system in expert hands. In septic system management, the time dose control box plays a pivotal role in systems that require precise dosing intervals for effluent dispersal. At Southern Water and Soil, we’ve become a leader in the septic industry with over 30 years of service in the **Dade City, FL** area. We provide comprehensive solutions for time dose control boxes. Our expertise ensures that your septic system operates efficiently, effectively, and in compliance with environmental regulations. ![Time Dose Control Box in Dade City, Florida](/wp-content/uploads/2023/12/2012-11-20-12.45.25-res.jpg) A **time dose control box** is a part of certain septic systems that regulate the dosing intervals of effluent to the drain field. Unlike conventional systems that operate on a demand-dose basis, time-dosed systems release effluent at scheduled intervals. This method maximizes treatment efficiency, extends the life of the drain field, and prevents system overload. The time dose control box manages this process. A **time dose control** **box** ensures the drain field is adequately utilized and manageable. Time-dosed dispersal allows for better wastewater treatment, ensuring the effluent has adequate treatment time before release. Controlled dosing also minimizes the risk of surface runoff and groundwater contamination. Our team brings unparalleled expertise to installing, maintaining, and repairing your time dose control box. We have the knowledge and skill to handle all aspects of your septic system, including the intricate workings of time dose control boxes. If you need a time dose control box solution or require service for your existing system, we are here to help. [Contact us today](/contact-southern-water-and-soil/) to learn more about our services and how we can ensure your septic system operates at its best. --- *At Southern Water and Soil, we install **time dose control boxes** in Brooksville, **[Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/time-dose-control-box/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Septic Tank Alarms, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-tank-alarms/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## Our team can help ease the stress of septic tank alarms with quick repair services. ![Septic Tank Alarms in Brooksville, Florida](/wp-content/uploads/2024/02/septicalarms-res.jpg)Owning a home with a septic system carries extra responsibilities, but having an experienced team by your side to assist with repair and maintenance needs can give you extra peace of mind. For instance, our team at Southern Water and Soil has over three decades of combined experience in the design, repair, and maintenance of septic systems in the **Brooksville, Florida** area, which makes us a great team to call when **septic tank alarms** have you worried. Septic tank alarms are put in place to alert you of possible issues within the septic system. There are numerous potential causes for these alarms, all of which our team can handle. For instance, septic tank alarms might sound due to high water use. Using too much water can overwork the septic system and stop it from treating wastewater properly. This could happen if you’ve had extra people in the house for a long period of time or if there is a water leak somewhere in your system. Additionally, if there are clogs in the drainfield or pipes, properly treated wastewater may not be able to move, which raises the water level in the septic tank and sets off the alarm. Or, if your septic system has a pump, it can stop working and stop the flow of wastewater, which will set off an alarm. If your **septic tank alarms** go off, you should not ignore it. Ignoring the alarm could cause bigger problems or even cause the system to fail. It’s important to call our team right away to assess the situation and create a plan to fix it. [Contact us](/contact-southern-water-and-soil/) today to learn more. --- *At Southern Water and Soil, we install **septic tank alarms** in [**Brooksville**](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-tank-alarms/), [Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-tank-alarms/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Septic Tank Alarms, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-tank-alarms/) **Published:** March 27, 2024 **Author:** Southern Water Soil **Content:** ## We can install, upgrade, or repair septic tank alarms. ![Septic Tank Alarms in Dade City, Florida](/wp-content/uploads/2024/02/septicalarms-feat-300x300.jpg)As a septic system owner, you don’t have to stress over your wastewater setup failing silently and causing messy, costly damages. **Septic tank alarms** provide you with immediate alerts before overflow disasters strike. However, septic alarms need proper setup and occasional troubleshooting to work properly. Our septic tank alarm specialists at Southern Water and Soil have over 30 years of knowledge. We’ve serviced traditional and advanced septic designs across residential and commercial properties in **Dade City, Florida**. We can install, upgrade, or repair septic tank alarm systems to keep them working for you. **Septic tank alarms** contain a float switch connected to a control panel inside the tank. When effluent rises too high or dips too low, the switch triggers an alarm alerting you of issues such as pump or pipe blockages, excess water usage overwhelming the system, power outages, and leaks or failures of tank components. This early detection is crucial for addressing problems before wastewater backs up, creating a real mess. Some advanced septic tank alarms can even send real-time text notifications. If you want to upgrade your alarm system or install a new one, our technicians can suggest alarms suited for new or existing tanks. We can also maintain your system by running routine tests on alarms to check backup power, calibrate floats, and ensure they function properly. We diagnose issues quickly if an alarm is falsely ringing or fails to sound when tanks overflow. Properly functioning septic tank alarms are important for detecting problems early – trust us, sewer backups can really ruin your day. [Contact us today](/contact-southern-water-and-soil/) to upgrade your alarm and stop worrying that your current alarm will let you down. --- *At Southern Water and Soil, we install **septic tank alarms** in [Brooksville](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-tank-alarms/), **[Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-tank-alarms/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Septic Control Panel, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-control-panel/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## The septic control panel is vital for the successful operation of the septic system. ![Septic Control Panel in Brooksville, Florida](/wp-content/uploads/2024/02/20160426_173042-res.jpg)Septic systems are essential for properly dealing with wastewater in homes that aren’t connected to a municipal sewage system. The **septic control panel** is one crucial component that is responsible for a wide variety of functions, but like any other technology, issues with this part can arise at any time. When that happens, it’s good to have our team at Southern Water and Soil by your side. Electrical problems are one of the most common problems with septic control panels. These panels depend on a group of linked sensors, alarms, and pumps. Any problem with the power source or parts that don’t work right can cause the system to fail. To avoid sudden breakdowns, it’s important to check on things regularly and repair broken parts right away. Speaking of sensors, since the system relies on sensors to measure water levels and other important factors, it is important to calibrate and update sensors on a regular basis to make sure the septic control panel works correctly. Additionally, since the septic control panel oversees the pumps that move waste water from the septic tank to the drain field, our team can offer repair and maintenance for the septic control panel to ensure the pumps keep working as they should. Another common concern for septic control panels is corrosion and weather damage. Septic control panels are usually put outside, where they are exposed to the weather. Corrosion from rain as well as fluctuating temperatures might affect the panels various parts. We can assess this situation as well to help ensure your system runs smoothly. **Septic control panels** make septic systems work better, but if they aren’t working as they should, the whole system can get out of whack. [Contact our team](/contact-southern-water-and-soil/) today in the **Brooksville, Florida** area to ensure your septic control panel is working to its full potential. --- *At Southern Water and Soil, we install **septic control panels** in [**Brooksville**](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-control-panel/), [Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-control-panel/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Septic Control Panel, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-control-panel/) **Published:** May 21, 2025 **Author:** Southern Water Soil **Content:** ## We’re equipped to repair or replace your septic control panel. ![Septic Control Panel in Dade City, Florida](/wp-content/uploads/2024/02/20160426_173042-res.jpg)Our team at Southern Water and Soil knows that it’s not uncommon for residential and commercial properties alike to rely on septic systems throughout the **Dade City, Florida** region. That’s why our skilled septic professionals offer comprehensive septic solutions, whether you need septic pumping services or **septic control panel** repairs. No job is too big or too small for our dedicated crew to tackle, and we’ll strive to earn your satisfaction with our high-quality workmanship, straightforward pricing, and stellar customer service. Your septic control panel is the device that monitors various aspects of your septic system, so if it malfunctions, it can give you incorrect readings and impact the efficiency of your system. For example, the septic control panel is responsible for measuring water levels, air pressure, and other crucial features that keep your system running smoothly. If the septic control panel starts giving incorrect readings or keeps giving you false alerts, we encourage you to contact us for assistance. Our team will arrive promptly at the designated time and carefully inspect your system. We’ll check the septic control panel, ensure that it is properly connected to all the relevant components, and locate the root cause of the issue. Once we find out what’s wrong, we’ll inform you of our findings and provide you with a quote for our repair services. If we discover that your **septic control panel** is too outdated or too badly damaged to be effectively repaired, we’ll recommend replacing it with a more efficient model instead, offering you greater reliability in the long run. For more information about our services or to schedule an appointment, please [reach out to us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **septic control panels** in [Brooksville](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-control-panel/), [**Dade City**](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-control-panel/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Septic Control Boxes, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-control-boxes/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## Septic control boxes play a vital role in maintaining septic systems. Septic systems are crucial in managing home wastewater when there is no access to municipal sewage treatment. These systems, as you can imagine, have many different parts that work together for successful performance and efficiency. One such part that is necessary for proper functioning is the septic control box. To help you get the most out of your septic system, our team at Southern Water and Soil offers repair and maintenance for **septic control boxes**. Continue reading to learn more about this essential component. ![Septic Control Boxes in Brooksville, Florida](/wp-content/uploads/2024/02/20160426_193136-res.jpg) Septic control boxes are designed to control the flow of effluent (wastewater) between the septic tank’s different levels and allow treated water to flow in the drain field. In doing so, they keep the drain field from overflowing and ensure that the effluent is spread out evenly so that it can be properly treated. Within septic control boxes, you’ll find the various parts below, each with their own role in the sewage management process: - **Float Switches:** Septic control boxes have float switches that check how much liquid is in the septic tank. These switches send messages to the control box, which then does things like turn on the pump or send wastewater to certain chambers. - **Pump Activation:** When the liquid level in the septic tank hits a certain level, the septic control box turns on the pump. This keeps the effluent moving to the drainfield at the right times, which stops backups and system breakdowns. - **Valve Controls:** Some **septic control boxes** have valves that let you change how much waste flows through the system. These valves can send effluent to different treatment areas, which makes the treatment process work better. Maintaining the septic control box is critical to keeping the septic system running smoothly. If you’re curious about the state of your septic control box, [contact our team](/contact-southern-water-and-soil/) in the **Brooksville, Florida** area today. --- *At Southern Water and Soil, we install **septic control boxes** in [**Brooksville**](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-control-boxes/), [Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-control-boxes/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Septic Control Boxes, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-control-boxes/) **Published:** March 26, 2024 **Author:** Southern Water Soil **Content:** ## Protect your investment with proactive control box service. Behind every properly operating septic system lies unsung heroes: the humble septic control boxes. Tucked away from plain view, this compact control panel orchestrates the distribution, treatment, and recycling of all wastewater produced by your home. Without septic control boxes, most systems would grind to a halt and fail inspection. At Southern Water and Soil, we specialize in the maintenance and repair of septic control boxes serving homes in **Dade City, Florida**. ![Septic Control Boxes in Dade City, Florida](/wp-content/uploads/2024/02/20160426_193136-res.jpg) We have more than 30 years of experience with these devices and have seen how technologically advanced they have become. Think of us as the “mission control” team for your system’s behind-the-scenes filtration technology. Our technicians understand every circuit, switch, and safeguard within commercial-grade control boxes to make them operate without fail. **Septic control boxes** monitor water volumes using float switches and meters, activating pumps when tanks reach target levels to prevent backups and overflows. They regulate treatment components and alert you when equipment needs service. Without this automation, septic systems would need constant manual oversight. It is critical to routinely check your control box connections for corrosion, test backup batteries, calibrate floats and switches, and confirm the proper cycling of the septic system. Without proper maintenance, **septic control boxes** can malfunction, causing complete system failures. Thankfully, when you have a preventative maintenance plan with our team, we can spot the deterioration of parts well before a problem occurs and provide the solutions necessary to keep your system operating properly. During routine maintenance visits, we can assess connections, provide backup battery swaps, waterproof cracked casings, and much more. [Connect](/contact-southern-water-and-soil/) with our control box service pros today to guard your septic system’s health. --- *At Southern Water and Soil, we install **septic control boxes** in [Brooksville](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/septic-control-boxes/), **[Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/septic-control-boxes/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Septic Repair and Maintenance Services, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-repair-and-maintenance-services/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## Turn to us whenever you need septic repair or maintenance—we are confident you will be happy with our results. Our team at Southern Water and Soil has over 30 years of experience in the septic industry, and in that time, we have dealt with countless septic emergencies. We understand more than anyone how unpleasant and disruptive septic problems can be, so we want to help you prevent them whenever possible. If you want to keep your septic system in good working order, we encourage you to take advantage of our **septic repair and maintenance services**. ![Septic Repair and Maintenance Services in Tampa, Florida](/wp-content/uploads/2023/04/lIfblyvg-res.jpeg) Scheduling regular septic repair and maintenance services will go a long way to prevent unexpected malfunctions in your septic system. Our team will inspect your septic system, including the tank, drain field, and lift stations (if you have any), to assess the condition of the various parts. We’ll make any necessary adjustments to restore your system to optimal condition. Another key part of septic maintenance services is regular pumping and cleaning of the tank, which our team can also take care of for you. Finally, if your system does malfunction despite our maintenance efforts, you can call us to get prompt, effective repair services. We’ll figure out what is causing the problem, correct that issue, and take care of any necessary cleanup so you don’t have to. We are proud to serve the community here in **Tampa, Florida**, and we want to help you take the best care of your septic system. If you are looking for experts you can trust to provide effective, reliable **septic repair and maintenance services**, simply [give us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic repair and maintenance services** in [Brooksville](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/), [Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-repair-and-maintenance-services/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-repair-and-maintenance-services/), and **[Tampa](/residential-septic-tampa-fl/septic-repair-and-maintenance-services/)**, Florida.* --- ### [Septic Repair and Maintenance Services, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-repair-and-maintenance-services/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## Keep things flowing by scheduling regular septic maintenance services. Many business owners and homeowners in the **Spring Hill, Florida** area rely on septic systems instead of municipal sewer systems, but not everyone understands how to properly maintain a private septic system. Whether you recently purchased a new property with a septic system or you’ve been noticing problems with your system, it’s important to find a reliable business you can trust for septic repair and maintenance services. ![Septic Repair and Maintenance Services in Spring Hill, Florida](/wp-content/uploads/2023/04/lIfblyvg-res.jpeg) Our experienced crew at Southern Water and Soil proudly serves the Spring Hill community, and we would be honored to be your trusted resource for **septic repair and maintenance services**. We have over 30 years of professional experience, and we’re equipped to work on residential, commercial, and industrial septic systems with proficiency. Our dedication to our customers and our work makes us second to none in this area, and we’d love to show you how our septic repair and maintenance services can make a difference on your property. A standard septic maintenance service will generally include a careful visual inspection of your entire septic system to check for leaks, loose or broken components, or other signs of damage. If we notice a minor issue during this process, we can usually fix it on the spot. Fixing small issues promptly is the best way to keep your septic system up and running, as it’ll help extend the lifespan of your system and prevent you from spending money on costly repairs in the future. If we notice more severe issues with your system, we’ll take note of the problems and discuss the situation with you. Our team will recommend repairing or replacing the component, depending on the level of damage, and you can then choose if you’d like us to handle the repair process. If you do, you can rest assured that we’ll do so with the utmost care and attention to detail to prevent any further issues with your septic system. To learn more about our **septic repair and maintenance services**, [give us a call today](/contact-southern-water-and-soil/)! --- *At Southern Water and Soil, we offer **septic repair and maintenance services** in [Brooksville](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/), [Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-repair-and-maintenance-services/), Orlando, Plant City, **[Spring Hill](/residential-septic-spring-hill-fl/septic-repair-and-maintenance-services/)**, and [Tampa](/residential-septic-tampa-fl/septic-repair-and-maintenance-services/), Florida.* --- ### [Septic Repair and Maintenance Services, Odessa, FL](https://southernsepticanddesign.com/residential-septic-odessa-fl/septic-repair-and-maintenance-services/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## Improve the performance and longevity of your system with our septic repair and maintenance services. Septic systems are amazing. They are small wastewater treatment facilities that are buried right outside of your home, business, or other property in **Odessa, Florida** or nearby. These systems usually operate for years without needing any major **septic repair and maintenance services**. That being said, every system will require periodic maintenance and repair, and when that time comes, don’t hesitate to reach out to us at Southern Water and Soil. ![Septic Repair and Maintenance Services in Odessa, Florida](/wp-content/uploads/2023/04/lIfblyvg-res.jpeg) When it comes to septic repair and maintenance services, we offer it all: - **Installations:** We are proud to design and deliver the best possible septic solutions. We use our knowledge, experience, and training to create a carefully designed system that operates properly and is a cost-effective solution to your needs. - **Inspections:** If you are considering purchasing a property, it is highly advisable that you have a septic inspection performed first. This will give you a chance to evaluate how the system is performing, how well it has been maintained, and how long it is likely to last. - **Repairs:** When repairs are needed, the stakes are high. Your septic system could damage your property if a backup occurs or could release hazardous material into the surrounding environment. - **Maintenance:** Regular maintenance, usually in the form of septic tank pumping and cleaning, is one of the most important measures you can take to ensure that your septic system operates properly in the long term. - **Replacements:** When the time comes to upgrade or replace your system, you can count on us to design and implement a superior solution that meets your needs in a cost-effective way. Ready to talk about the **septic repair and maintenance services** you need? [Give us a call](/contact-southern-water-and-soil/) now. --- *At Southern Water and Soil, we offer **septic repair and maintenance services** in [Brooksville](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/), [Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [**Odessa**](/residential-septic-odessa-fl/septic-repair-and-maintenance-services/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-repair-and-maintenance-services/), and [Tampa](/residential-septic-tampa-fl/septic-repair-and-maintenance-services/), Florida.* --- ### [Septic Repair and Maintenance Services, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## We can take care of all the septic repair and maintenance services you need. It is easy to forget about your septic system until something goes wrong. While most residential and commercial septic systems are designed to function well for years, neglecting repairs and maintenance entirely is a recipe for disaster. Neglected septic systems may get overloaded, and waste may even back up into your property, creating a hazardous, unpleasant, and costly mess for you to clean up. ![Septic Repair and Maintenance Services in Brooksville, Florida](/wp-content/uploads/2023/04/lIfblyvg-res.jpeg) No matter what type of property you own in **Brooksville, Florida** or nearby, we can take care of all the **septic repair and maintenance services** you need. At Southern Water and Soil, we are committed to doing it right the first time and ensuring that your septic system is functioning optimally. When we arrive at your property, we will carefully inspect your system and assess its condition and functionality. One of the most common septic repair and maintenance services is a pump-out of the septic tank. We ensure that there is no accumulation of excess sludge and other solid waste buildup. This is also the ideal time to perform a more thorough inspection of your septic system and make any minor repairs that may be needed. **Septic repair and maintenance services** are key to improving the performance and protecting the longevity of your septic system. If you have any questions about how to maintain and protect your septic system, we are always happy to help. [Reach out to us](/contact-southern-water-and-soil/) today with your septic needs. We will be happy to schedule an appointment with one of our experienced technicians. --- *At Southern Water and Soil, we offer **septic repair and maintenance services** in [**Brooksville**](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/), [Dade City](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-repair-and-maintenance-services/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-repair-and-maintenance-services/), and [Tampa](/residential-septic-tampa-fl/septic-repair-and-maintenance-services/), Florida.* ### Similar Services We Offer: --- ### [Septic Repair and Maintenance Services, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## We’re confident in our ability to provide septic repair and maintenance services that will exceed your expectations. Dealing with a problem with your septic system is never a fun experience. Depending on the scope of the issue, you may have a slow-moving drain or a backup on your property. But if you’re in or near **Dade City, Florida**, you can count on our team at Southern Water and Soil to perform **septic repair and maintenance services**. ![Septic Repair and Maintenance Services in Dade City, Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/04/lIfblyvg-res.jpeg?lossy=1&strip=0&webp=1) We have experienced and knowledgeable technicians who can diagnose all types of problems and come up with resolutions. Our team has more than three decades of combined experience on septic and wastewater projects, so we’re confident in our ability to provide septic repair and maintenance services that will exceed your expectations. Every property owner with a septic system in place should keep up with regular maintenance. The most critical maintenance tasks include pumping and cleaning the tank, as this process prevents excess waste from accumulating and backing up or causing damage to the system. It’s also worthwhile to have the system inspected routinely, as a technician can find and resolve minor issues that could become larger down the road. Regular septic maintenance helps to increase the performance and longevity of your system, so it’s a worthwhile investment. When you contact us for septic repair and maintenance services, we’ll send someone to your property to assess the situation and come up with a plan. Our technicians also provide education to new septic owners so they know how to take care of the system and understand what to expect. [Reach out today](/contact-southern-water-and-soil/) to schedule **septic repair and maintenance services**. ### FAQs About Septic Repair and Maintenance Services Maintaining your septic system in good working order is key for several reasons. However, even with the best care, it might still need repair occasionally. This is why it’s a good idea to have a team on your side that can both maintain and repair the system. Over the years, our team at Southern Water and Soil has helped a variety of clients with their septic needs, which has led to answering quite a few questions about them as well. Keep reading to see some of the questions we’re asked most often. ##### Hidden ##### What signs point to a possible problem with my septic system? Sluggish drains, [sewage](/residential-septic-services-dade-city-fl/onsite-sewage-treatment-and-disposal-system-conversions/) backups, bad smells, excessively green and lush vegetation over the drain field, and gurgling noises coming from plumbing fixtures are typical red flags. It’s imperative to have your system checked out if you notice any of these. ##### Can I enhance the performance of my septic system with additives? Additives are usually unnecessary and may possibly cause problems for the system. Maintaining a functioning septic system is more dependent on routine inspections and prudent water use. ##### What materials should I not put in my septic tank? Steer clear of flushing chemicals, grease, nonbiodegradable objects, and large quantities of home cleansers. These may upset the system’s natural equilibrium, causing obstructions or harm. ##### What is the average cost of repairing a septic system? The kind and severity of the problem determine how much a septic system repair will cost. Our team can perform an inspection to assess the current condition of your system and create a plan for repairs. Once that’s completed, we can give you a quote and review your options so that you can determine the next steps. *At Southern Water and Soil, we offer **septic repair and maintenance services** in [Brooksville](/residential-septic-brooksville-fl/septic-repair-and-maintenance-services/), [**Dade City**](/residential-septic-dade-city-fl/septic-repair-and-maintenance-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-repair-and-maintenance-services/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-repair-and-maintenance-services/), and [Tampa](/residential-septic-tampa-fl/septic-repair-and-maintenance-services/), Florida.* ### Similar Services We Offer: --- ### [Septic Pump-outs, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-pumping-services/septic-pump-outs/) **Published:** March 27, 2024 **Author:** Southern Water Soil **Content:** ## When you partner with us, your septic system is in capable hands. Proper design, installation, and regular maintenance are key to a septic system’s longevity and performance. At Southern Water and Soil, we have a full spectrum of septic system services to keep your system running, including handling the ever-important septic pump-outs. We take a comprehensive approach to septic system management in the **Dade City, Florida**, area, backed by over 30 years of industry experience. ![Septic Pump-outs in Dade City, Florida](/wp-content/uploads/2023/04/Z6BTXZE8-res.jpeg) Precision during the installation phase determines how well your septic system will perform, and our installation services guarantee that every component of your system is installed with meticulous attention to detail. This ensures efficient operation and reduces unnecessary maintenance. Our team employs the latest technologies and adheres to industry standards, giving you a septic system tailored to your property. By ensuring your system is correctly sized and configured from the outset, we minimize the risk of overloading the system, which can lead to premature **septic pump-outs**. Our team can work with you to determine the best schedule for your required septic pump-outs, ensuring they occur neither too frequently nor too infrequently. The regular maintenance we provide during **septic pump-outs** helps to identify and address potential issues before they escalate. We inspect the tank, check system components, and confirm that the system operates as intended, which can significantly reduce the frequency of septic pump-outs. Our professionals will mitigate leaks, blockages, and system imbalances before they call for septic pump-outs. When you partner with us, your septic system is in capable hands. Our holistic management strategy aims to maintain your system for the long haul. For more information about our comprehensive septic system services or to schedule a consultation, [contact us today](/contact-southern-water-and-soil/). Our team is ready to provide you with expert care. --- *At Southern Water and Soil, we perform **septic pump-outs** in Brooksville, **[Dade City](/residential-septic-dade-city-fl/septic-pumping-services/septic-pump-outs/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Septic Pumping Companies, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-pumping-services/septic-pumping-companies/) **Published:** August 1, 2024 **Author:** Southern Water Soil **Content:** ## Finding the right team is crucial to the health and longevity of your septic system. Maintaining a functioning septic system is critical for any **Tampa, Florida** property owner, and regular pumping is an essential component of that maintenance. However, with so many options for septic pumping companies, it can be challenging to know which one to choose. Our team at Southern Water and Soil understands this, which is why we work hard to ensure our current and potential customers feel confident in our services. Of course, it helps that we have more than 30 years of combined experience on our side. Still, we suggest considering a variety of factors when deciding which company is best for you. ![Septic Pumping Companies in Tampa, Florida](/wp-content/uploads/2023/12/2012-11-21-10.30.10-res.jpg) Reputable **septic pumping companies** should have the tools, knowledge, and experience needed to ensure your septic system functions well. Additionally, they should offer a variety of services to meet your needs. Perhaps even more important is the way they communicate with you. You should feel comfortable asking any questions you have and confident in the answers you receive. For us, we enjoy providing our customers with knowledge about their septic systems, and we place a high value on clear communication. We also consistently add to our training and ensure we’re using the latest tools and techniques. Customer feedback is another thing to consider when researching **septic pumping companies**. A lack of testimonials or reviews may be a warning flag. Reliable companies should have a track record of satisfied consumers who are prepared to recommend their services. Check online review sites and social media to find the information you’re looking for. Professionalism and attention to detail are also key indicators that you’ve found a company you can trust. Is the company responsive? Do they show up on time for appointments? If you answer “no” to these questions, it’s a good idea to continue researching septic pumping companies. Choosing the correct septic pumping company is critical to the health and longevity of your septic system. If you’re in the Tampa area, we invite you to [contact](/contact-southern-water-and-soil/) our team to see what we have to offer. --- *At Southern Water and Soil, we are proud to be one of the best **septic pumping companies** serving Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-pumping-services/septic-pumping-companies/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-pumping-services/septic-pumping-companies/), and **[Tampa](/residential-septic-tampa-fl/septic-pumping-services/septic-pumping-companies/)**, Florida.* --- ### [Septic Pumping Companies, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-pumping-services/septic-pumping-companies/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## We are one of the most reliable septic pumping companies in the state, and you can count on us to take good care of your system. If you are not familiar with how a septic system works, allow our team at Southern Water and Soil to explain: instead of your plumbing being connected to a local sewer system, it instead connects to a private septic tank. The septic tank is a concrete box installed underground on your property, and all the wastewater from your building flows into it. Liquids then flow out of the box and into the drain field, where they are filtered before seeping back into the ground. Solids, on the other hand, sink to the bottom of the box and remain there until they are removed. The process of removing this waste from the septic tank is known as septic pumping, and this service is performed by dedicated **septic pumping companies** like ours. ![Septic Pumping Companies in Spring Hill, Florida](/wp-content/uploads/2023/12/2012-11-21-10.30.10-res.jpg) Septic pumping companies will take care of this essential part of septic maintenance, so you don’t have to. Our team will come to your property with a large tanker truck, then use vacuum hoses to move waste from the tank on your property into the one on the back of our vehicle. Once your septic tank is empty, we’ll reel in the hose and take the truck to an appropriate treatment facility for disposal. Our team is proud to be a part of the community here in **Spring Hill, Florida**, and we want to help you take care of your septic system. If you are looking for effective, reliable **septic pumping companies** in the area, look no further—[give us a call](/contact-southern-water-and-soil/) today to enlist the help of our experts. --- *At Southern Water and Soil, we are proud to be one of the best **septic pumping companies** serving Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-pumping-services/septic-pumping-companies/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, **[Spring Hill](/residential-septic-spring-hill-fl/septic-pumping-services/septic-pumping-companies/)**, and [Tampa](/residential-septic-tampa-fl/septic-pumping-services/septic-pumping-companies/), Florida.* --- ### [Septic Pumping Companies, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-pumping-services/septic-pumping-companies/) **Published:** March 26, 2024 **Author:** Southern Water Soil **Content:** ## We are the gold standard for septic cleaning and maintenance. If you own a home or business in **Dade City, Florida**, you must regularly pump out your septic tank to avoid disaster. For over 30 years, our team at Southern Water and Soil has provided the gold standard for septic cleaning and maintenance to residential and commercial properties. Regarding the crucial task of septic pumping, we rise above other septic pumping companies to deliver service and value. ![Septic Pumping Companies in Dade City, Florida](/wp-content/uploads/2023/12/2012-11-21-10.30.10-res.jpg) Juggling contractors around your calendar can give anyone a headache, but with our online booking and responsive team of septic pumping pros, securing a service appointment with us couldn’t be simpler. We know you have better things to do than wait around, so our seasoned technicians complete each pump out thoroughly and efficiently. They carefully inspect your whole system for any issues during cleaning and provide troubleshooting recommendations as needed. Unlike many other **septic pumping companies**, you can trust our crew to do the job correctly the first time. We use advanced trucks and industrial pumps to vacuum out solids and effluent, leaving tanks fully clean. Our equipment precisely monitors fluid levels to prevent over- or under-pumping that could damage your system. All septic waste removed gets disposed of at certified treatment facilities that process it responsibly, and we comply with all regulations to protect water resources and the environment. We also offer installations, repairs, component replacements, permitted expansions, and inspections to keep your septic system in peak condition. Despite our superb quality of service, our septic pumping rates remain reasonable, and we provide free quotes upfront, so you know what to expect cost-wise. We believe in transparency, which sets us apart from **septic pumping companies**. Our expertise delivers individualized attention, efficient cleaning, and long-term savings. Don’t hire just any pumping company – hire professionals who can deliver unparalleled service, every time. [Contact us](/contact-southern-water-and-soil/) to schedule an affordable septic pumping service. --- *At Southern Water and Soil, we are proud to be one of the best **septic pumping companies** serving Brooksville, **[Dade City](/residential-septic-dade-city-fl/septic-pumping-services/septic-pumping-companies/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/septic-pumping-services/septic-pumping-companies/), and [Tampa](/residential-septic-tampa-fl/septic-pumping-services/septic-pumping-companies/), Florida.* --- ### [Septic Pumping Services, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-pumping-services/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## We are thorough and efficient at pumping out your full septic tank. When your septic tank is full, there will be many noticeable signs. Slower drainage and foul smells coming from your drains both point to needing a septic pump-out, a vital part of septic maintenance that you’ll need to keep your septic system working properly. When your septic tank is full of waste, it will need to be pumped out using **septic pumping services**. Otherwise, there won’t be anywhere else for the waste to go, and when too much waste accumulates in the tank, you may encounter leaks or other damages. ![Septic Pumping Services in Tampa, Florida](/wp-content/uploads/2023/04/7Ktxe6CU-res.jpeg) Our septic pumping services utilize all of the necessary equipment combined with our experience in the septic industry to completely pump out your tank efficiently and safely, so your property isn’t damaged or ruined. Here at Southern Water and Soil, we are experts in helping you protect your property through proper waste management, and our septic pumping services are just what you need to help prevent a full septic tank from overflowing and damaging your property. If you’re in the **Tampa, Florida** area and are looking for a septic pumping company to take care of your septic tank, look no further than our team. For over 30 years, we’ve been serving the area with septic tank services adaptable to any homeowner’s situation. Every home’s needs are unique and deserve a qualified septic company to address them properly, so whether you need a pump-out service to clean your full septic tank or need a new septic system designed and installed on your property, we are here to help. [Contact us](/contact-southern-water-and-soil/) today to learn more about our **septic pumping services** or to schedule an appointment. --- *At Southern Water and Soil, we offer **septic pumping services** in [Brooksville](/residential-septic-brooksville-fl/septic-pumping-services/), [Dade City](/residential-septic-dade-city-fl/septic-pumping-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-pumping-services/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-pumping-services/), and [**Tampa**](/residential-septic-tampa-fl/septic-pumping-services/), Florida.* --- ### [Septic Pumping Services, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-pumping-services/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## Count on our experienced crew for all your septic pumping needs. If you own a home or business in the **Spring Hill, Florida** area, your property may not be connected to the municipal sewer system. If this is the case, then you’ll have some extra responsibilities when it comes to maintaining your property’s septic system. Fortunately, our team at Southern Water and Soil has over 30 years of experience in this industry, and we’re prepared to assist you with a complete range of septic pumping services. ![Nitrogen-Reducing Septic System in Spring Hill, Florida](/wp-content/uploads/2023/04/7Ktxe6CU-res.jpeg) If you’re unfamiliar with septic systems, one of the most important things to know is that the tank needs to be pumped out regularly. The septic tank holds and stores all solid waste while allowing liquid waste to continue flowing through the system and out into the drain field. Over time, however, the tank will fill up with sludge and require professional septic pumping services. Generally, properties need **septic pumping services** every 3 to 5 years, but this can vary depending on what kind of property it is, how large the tank is, how many people regularly use the system, and other factors. If you’re not sure how often you need septic pumping services, you can give our team a call to learn how to best take care of your septic system. You can rely on us to assess the condition of your septic system overall and check the capacity of your tank. Our experienced crew can perform **septic pumping services** for all types of properties, including commercial, residential, and industrial systems. Keep your septic system in good working order and prevent unpleasant sewage backups by [contacting us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic pumping services** in [Brooksville](/residential-septic-brooksville-fl/septic-pumping-services/), [Dade City](/residential-septic-dade-city-fl/septic-pumping-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-pumping-services/), Orlando, Plant City, [**Spring Hill**](/residential-septic-services-dade-city-fl/septic-pumping-services/), and [Tampa](/residential-septic-tampa-fl/septic-pumping-services/), Florida.* --- ### [Septic Pumping Services, Odessa, FL](https://southernsepticanddesign.com/residential-septic-odessa-fl/septic-pumping-services/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## Don’t put off your septic pumping services—schedule them today. Out of sight, out of mind, right? That’s where most septic systems are—under the ground, out of sight. The problem is if you forget about them for too long, you may have smelly, unpleasant, and expensive consequences in the form of a septic backup in your home or business. Regular **septic pumping services** can help you avoid this problem. This service is also a great opportunity to have your septic system evaluated for minor problems. It is much easier and more cost-effective to complete small repairs before they turn into major issues. ![Septic Pumping Services in Odessa, Florida](/wp-content/uploads/2023/04/7Ktxe6CU-res.jpeg) At Southern Water and Soil, we perform septic pumping services for all types of properties: - **Residential:** While single-family homes often have the simplest types of septic systems, regular maintenance is still key for a system to perform optimally and to protect the longevity of the system overall. - **Commercial:** Keep your business operating normally by ensuring that regular maintenance is taken care of when needed. Your employees, your customers, and all other stakeholders will appreciate your commitment to their safety and convenience. - **Industrial:** We can assess and evaluate even the most complex septic systems, so don’t hesitate to reach out to us for all your septic needs. - **Multi-Unit:** Apartment complexes and other multi-unit properties can have complex septic designs, but it’s nothing we haven’t seen in our three decades of experience. Regardless of what type of property you have in **Odessa, Florida** or nearby, don’t put off your **septic pumping services**—schedule them today by [giving us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic pumping services** in [Brooksville](/residential-septic-brooksville-fl/septic-pumping-services/), [Dade City](/residential-septic-dade-city-fl/septic-pumping-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [**Odessa**](/residential-septic-odessa-fl/septic-pumping-services/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-pumping-services/), and [Tampa](/residential-septic-tampa-fl/septic-pumping-services/), Florida.* --- ### [Septic Pumping Services, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-pumping-services/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## Avoid unpleasant backups and other problems with regular septic pumping services. While it may seem that pumping out a septic tank isn’t that complicated, it is definitely not a do-it-yourself task. It requires specialized equipment and training to ensure that the surrounding environment is not contaminated with hazardous waste. It’s also important to ensure that your septic system is not harmed by the **septic pumping services**. At Southern Water and Soil, we have a team of professional technicians standing by to perform your required septic pumping services at your residential, commercial, or industrial property near **Brooksville, Florida**. We can remove and dispose of your septic waste safely. ![Septic Pumping Services in Brooksville, Florida](/wp-content/uploads/2023/04/7Ktxe6CU-res.jpeg) Septic pumping services are an important part of keeping your septic system operational. It doesn’t have to be done that often (usually every 3 to 5 years), but it is of the utmost importance. Most septic tanks are concrete boxes buried underground. When the septic tank becomes overloaded with sludge and solid waste, it can crack, or septic backups can occur. Not only are these events smelly and unpleasant, but they can also be hazardous, as waste contains harmful bacteria. They can also cause major damage to the interior of your property. Avoid unpleasant backups and other problems with regular **septic pumping services**. Cleaning out your septic tank also gives us an opportunity to carefully inspect your septic tank and make any minor repairs before issues lead to more costly repairs later. You can count on us to help improve the performance of your septic system and to help protect its longevity, so [reach out now](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic pumping services** in [**Brooksville**](/residential-septic-brooksville-fl/septic-pumping-services/), [Dade City](/residential-septic-dade-city-fl/septic-pumping-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-pumping-services/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-pumping-services/), and [Tampa](/residential-septic-tampa-fl/septic-pumping-services/), Florida.* --- ### [Septic Pumping Services, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-pumping-services/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## Our technicians have the training and equipment needed to tackle septic pumping services. All septic systems have a few key components, one of which is the tank. This concrete box sits beneath the ground and connects to the indoor plumbing system to store the liquid and solid waste that come through the drains. Although wastewater is treated and exits the tank, solid waste stays behind and forms sludge. Over time, the tank can become overloaded with sludge, which is why it’s so important to keep up with regular septic maintenance. One of the critical maintenance tasks that no septic owner can afford to skip is pumping. ![Septic Pumping Services in Dade City, Florida](/wp-content/uploads/2023/04/7Ktxe6CU-res.jpeg) Septic pumping involves using a truck to remove the solid waste from the tank and dispose of it properly. Only a trained and skilled professional should perform **septic pumping services**. At Southern Water and Soil, we can take care of this and other septic maintenance tasks for clients located throughout **Dade City, Florida** and much of the surrounding area. Our technicians have the training and equipment needed to tackle septic pumping services. We can take care of it on both residential and commercial properties. If you fail to keep up with septic pumping services, your tank may get overloaded with sludge, resulting in a sewage backup. This is a highly unpleasant and hazardous situation that you should try to avoid at all costs. Sewage can cause serious damage to your property, including the landscaping on your property. Additionally, if sludge moves into the drain field, it can cause environmental damage and cause the components to break down prematurely. If it’s time for **septic pumping services** on your property, [reach out to us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we offer **septic pumping services** in [Brooksville](/residential-septic-brooksville-fl/septic-pumping-services/), [**Dade City**](/residential-septic-dade-city-fl/septic-pumping-services/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/residential-septic-odessa-fl/septic-pumping-services/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-pumping-services/), and [Tampa](/residential-septic-tampa-fl/septic-pumping-services/), Florida.* ### Similar Services We Offer: --- ### [Septic Permit Application, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-permit-application/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## You can count on us to get the septic permit application process right. Septic systems are designed to contain sewage and treat wastewater, so they are therefore extremely important for public health. When a septic system malfunctions, it doesn’t just affect the property owner; it will also affect the people and animals who might be exposed to contaminated groundwater because of it. With this in mind, it’s easy to see why builders are required to get permits before installing or modifying a septic system. Our team at Southern Water and Soil has over 30 years of experience in the septic industry, and we have been through the **septic permit application** process countless times. You can count on us to take care of every part of your septic project, including the application phase. ![Septic Permit Application in Tampa, Florida](/wp-content/uploads/2023/04/18JQa9Io-res.jpeg) During the **septic permit application** process, we will ask you for information about your property. You might also need to have a site evaluation conducted and include a copy of the results along with the application itself. As part of the application process, our team will also submit a copy of the proposed design for your new (or updated) septic system. The local permitting organization will then review the application and either send it back for changes or approve it and let us start work on the project. Our team will adjust the plans as necessary until the permit is granted. Our team is proud to serve the community in **Tampa, Florida**, and we want to help you with all your septic needs. If you are looking for a team you can trust to take care of every part of your project, including the septic permit application, we encourage you to [give us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we can help with **septic permit applications** in [Brooksville](/residential-septic-brooksville-fl/septic-permit-application/), [Dade City](/residential-septic-dade-city-fl/septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-permit-application/), and **[Tampa](/residential-septic-tampa-fl/septic-permit-application/)**, [Florida](/residential-septic-florida/septic-permit-application/).* --- ### [Septic Permit Application, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-permit-application/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## We can streamline the septic permit application process. If you’re thinking about installing or upgrading a septic system on your **Spring Hill, Florida** property, the first thing you’ll need to do is submit a septic permit application. Filling out a septic permit application can be complex and time-consuming, but when you have an experienced septic company on your side, it’ll become far easier. ![Septic Permit Application in Spring Hill, Florida](/wp-content/uploads/2023/04/18JQa9Io-res.jpeg) At Southern Water and Soil, we’re proud to have over 30 years of experience in the septic industry, so we understand exactly what information is necessary for your **septic permit application**. Our team can handle the necessary paperwork and ensure the local authorities get the information they need as soon as possible. In turn, this will allow us to get to work on your new septic system or upgraded components. A septic permit application is required to prevent negative environmental impacts and other unpleasant situations that may arise from a poor septic system installation job. Fortunately, with a crew like ours to assist you, you can rest assured that everything will be well taken care of. We will carefully inspect your property to get all the relevant information needed for the application, help create or adjust the septic system design, and double-check all the details before sending in the application for approval. Instead of trying to tackle the complex **septic permit application** process on your own, leave it to the pros by contacting our team today. We’ll strive to exceed your expectations and provide you with the outstanding customer service you deserve. If you’d like to learn more or schedule an appointment, [reach out to us](/contact-southern-water-and-soil/) now to get started. --- *At Southern Water and Soil, we can help with **septic permit applications** in [Brooksville](/residential-septic-brooksville-fl/septic-permit-application/), [Dade City](/residential-septic-dade-city-fl/septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, **[Spring Hill](/residential-septic-spring-hill-fl/septic-permit-application/)**, and [Tampa](/residential-septic-tampa-fl/septic-permit-application/), [Florida](/residential-septic-florida/septic-permit-application/).* --- ### [Septic Permit Application, Florida](https://southernsepticanddesign.com/residential-septic-florida/septic-permit-application/) **Published:** August 21, 2023 **Author:** Southern Water Soil **Content:** ## Let us help you with your septic permit application. Getting a septic permit is essential if you want to build, install, or change a septic system on your land. Even though you can apply for a permit on your own, the process is lengthy and may require more information than you have. At Southern Water and Soil, we have over 30 years of experience in the septic industry and have helped countless clients with their **septic permit applications**. Consider the following ways we can help, and then give our team a call. ![Septic Permit Application in Florida](/wp-content/uploads/2023/04/18JQa9Io-res.jpeg) - **Expertise and Knowledge.** Our team understands the various rules, codes, and requirements for septic systems in **Florida**. Our knowledge can help ensure that your septic permit application is correct, reducing the chance of being delayed or turned down. Additionally, the requirements for a permit can vary based on where you live. Since we’ve worked in the area for a number of years, we’re current on what is needed for permit approval. - **Customized Design:** Our team will evaluate your property’s soil type, water table level, and available room to design a septic system that fits your property’s needs. This personalized method not only makes sure the system works but also makes it work as efficiently as possible and last as long as possible. - **We Save You Time.** A septic permit application can be complicated and take a lot of time. Working with our team can reduce the time you spend on it, as we can help you navigate the paperwork, prepare the necessary documents, and provide the information you need. This allows you to focus on other responsibilities. - **Quick Problem-Solving.** Issues might arise during the process that our team can fix right away. By handling these issues quickly, you can avoid costly setbacks and changes that could happen if you miss important details in your septic permit application. - **Higher Approval Rates.** Allowing our team to help with your **septic permit application** makes it more likely that your application will be complete and correct. Having that peace of mind helps when you’re up against a deadline. As you can see, you receive several benefits when our team assists with your septic permit application. [Contact our team](/contact-southern-water-and-soil/) today to learn more. --- *At Southern Water and Soil, we can help with **septic permit applications** in [Brooksville](/residential-septic-brooksville-fl/septic-permit-application/), [Dade City](/residential-septic-dade-city-fl/septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-permit-application/), and [Tampa](/residential-septic-tampa-fl/septic-permit-application/), [**Florida**](/residential-septic-florida/septic-permit-application/).* --- ### [Septic Permit Application, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-permit-application/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## We’ll acquire the permit for your septic project. Submitting a **septic permit application** is one of the first things you must do when you either modify or install a septic system on your property. In most cases, the septic permit application will include information about your property and will require you to submit the proposed design plans for your system. You may also need to provide details about the site evaluation, which is an evaluation that assesses the soil and other environmental conditions of your site. ![Septic Permit Application in Brooksville, Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/04/18JQa9Io-res.jpeg?lossy=1&strip=0&webp=1) Once you fill out your septic permit application, the local health department or government uses the information included to approve the septic system design. The department also ensures the design complies with local and state regulations for safety, public health, and environmental protection. While standard, filling out a septic permit application can take time. And if you do not have all the details correct, you may have to edit and resubmit this application, delaying your project. Instead of spending your time on a septic permit application, let us at Southern Water and Soil take over. We can not only help you fill out the application, but we can also ensure you acquire the right permit for the project. We have helped many people in the **Brooksville, Florida** area fill out successful **septic permit applications** and acquire the necessary permits for their installation or modification project. [Contact us](/contact-southern-water-and-soil/) today if you have any questions about getting a permit for your project or if you need help with the application. ### FAQs About Septic Permit Applications If you’re new to septic systems or you’ve not had to have yours modified since owning your property, you might not realize that you need a septic permit application prior to changing or installing a new system. While the paperwork might seem simple at first, it can cause quite a few frustrations and delays, which is why our team often assists our customers with their applications. To learn more about this process, check out the questions we’re frequently asked below. ##### Hidden ##### What details do I need to fill out the septic permit application? A [septic permit](/commercial-septic-dade-city-fl/commercial-septic-permits/) application usually needs information on the property, including its size, location, and kind of soil. It also contains information on the design, capacity, and proximity to water sources of the suggested septic system. ##### What happens if my application for a septic permit is incorrect or incomplete? Inaccurate or incomplete applications may result in denials and delays. Regulators need accurate data to make sure septic systems adhere to environmental and health regulations. With over 30 years of combined experience in the septic industry, our team is familiar with the intricacies of the form and can help you avoid issues that might arise. ##### Is there a way for me to appeal a denied septic permit application? You can appeal a denied septic permit application in many situations, but the appeals procedure can be laborious and necessitate further paperwork or changes to the original application. Getting expert assistance throughout the first application process might reduce the likelihood of rejection and the requirement for an appeal. ##### After submitting the application, how long does it take to get a septic permit? Several variables, including the project’s complexity, local laws, and the effectiveness of the regulatory body, affect how long it takes to get a septic permit. *At Southern Water and Soil, we can help with **septic permit applications** in [**Brooksville**](/residential-septic-brooksville-fl/septic-permit-application/), [Dade City](/residential-septic-dade-city-fl/septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-permit-application/), and [Tampa](/residential-septic-tampa-fl/septic-permit-application/), [Florida](/residential-septic-florida/septic-permit-application/).* --- ### [Septic Permit Application, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-permit-application/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## We can help you obtain a septic permit for your project. When installing or modifying a septic system on your property, you must submit a **septic permit application**. A septic permit application usually includes information about your property, the proposed septic system design, and details about the site evaluation, which is a process designed to assess the soil and other environmental conditions of the site. The application is then used by the local government or health department to evaluate and approve the proposed septic system design to ensure it meets local and state regulations for public health, safety, and environmental protection. ![Septic Permit Application in Dade City, Florida](/wp-content/uploads/2023/04/18JQa9Io-res.jpeg) Filling out a septic permit application is a lengthy process, and you want to make sure you have all the details correct before submittal. Prior to modifying or installing a septic system, leave this process to us at Southern Water and Soil. We can help you obtain a septic permit for your project by taking on the responsibility of filling out and submitting your septic permit application to the proper local authorities. Thanks to our 30+ years of experience in the septic industry, we know exactly what should be included in a septic permit application. We are also experts regarding septic system installations and modifications and will ensure any changes to your property and wastewater disposal system are done properly. If you need help with a **septic permit application** here in the **Dade City, Florida** area, we can help. [Contact us](/contact-southern-water-and-soil/) today to learn more and to schedule an appointment with our team. --- *At Southern Water and Soil, we can help with **septic permit applications** in [Brooksville](/residential-septic-brooksville-fl/septic-permit-application/), [**Dade City**](/residential-septic-dade-city-fl/septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-permit-application/), and [Tampa](/residential-septic-tampa-fl/septic-permit-application/), [Florida](/residential-septic-florida/septic-permit-application/).* --- ### [Septic Treatment Systems, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-engineering/septic-treatment-systems/) **Published:** April 23, 2023 **Author:** Southern Water Soil **Content:** ## Explore your options for a septic treatment system. ![Septic Treatment Systems in Dade City, Florida](/wp-content/uploads/2021/11/2013-07-10-14.34.05.jpg)There are many types of septic treatment systems available today. At Southern Water and Soil, we often recommend **septic treatment systems** with places where the soil is shallow, but you need a reliable, effective way to treat wastewater onsite before its final disposal into the ground. Most of the time, we equip septic treatment systems with a pressure distribution drain field, either with a drip tube or trench. Some of the most common types of septic treatment systems found here in the **Dade City, Florida** area include sand mounds, sand filters, and aerobic treatment components. We want your septic treatment system to work as optimally as possible for your unique site, so we can help you with the following: - **Permitting –** We will acquire the right permits from municipal and county agencies to get your project underway. - **Design –** Septic treatment systems vary from property to property. Our engineers and septic professionals can design a treatment system for your property that accounts for its specific features for maximum wastewater treatment. - **Installation –** We can install your new septic treatment system with ease. We will make sure that everything is installed correctly and completely operational before signing off on your project. For all things **septic treatment systems**, you can count on our highly qualified, reliable, and professional team. We can tell you more about how these systems work or how we can help you design a septic system for your property. [Contact us today](/contact-southern-water-and-soil/)! --- *At Southern Water and Soil, we install **septic treatment systems** in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/septic-engineering/septic-treatment-systems/)**,** Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/septic-services-tampa-fl/septic-engineering/septic-treatment-systems/), Florida.* --- ### [Septic Treatment Systems, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-engineering/septic-treatment-systems/) **Published:** November 16, 2021 **Author:** Southern Water Soil **Content:** ## Explore your options for a septic treatment system. ![Septic Treatment Systems in Tampa, Florida](/wp-content/uploads/2021/11/2013-07-10-14.34.05.jpg)There are many types of septic treatment systems available today. At Southern Water and Soil, we often recommend **septic treatment systems** with places where the soil is shallow, but you need a reliable, effective way to treat wastewater onsite before its final disposal into the ground. Most of the time, we equip septic treatment systems with a pressure distribution drain field, either with a drip tube or trench. Some of the most common types of septic treatment systems found here in the **Tampa, Florida** area include sand mounds, sand filters, and aerobic treatment components. We want your septic treatment system to work as optimally as possible for your unique site, so we can help you with the following: - **Permitting –** We will acquire the right permits from municipal and county agencies to get your project underway. - **Design –** Septic treatment systems vary from property to property. Our engineers and septic professionals can design a treatment system for your property that accounts for its specific features for maximum wastewater treatment. - **Installation –** We can install your new septic treatment system with ease. We will make sure that everything is installed correctly and completely operational before signing off on your project. For all things **septic treatment systems**, you can count on our highly qualified, reliable, and professional team. We can tell you more about how these systems work or how we can help you design a septic system for your property. [Contact us today](/contact-southern-water-and-soil/)! --- *At Southern Water and Soil, we install **septic treatment systems** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-engineering/septic-treatment-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [**Tampa**](/septic-services-tampa-fl/septic-engineering/septic-treatment-systems/), Florida.* --- ### [Performance-Based Septic Systems, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-engineering/performance-based-septic-systems/) **Published:** May 30, 2017 **Author:** Southern Water Soil **Content:** ## Performance based septic systems offer treatment solutions at affordable costs for homeowners in Tampa. ![Performance-Based Septic Systems in Tampa, Florida](/wp-content/uploads/2017/05/performancebasedsepticsystem.jpg) The State of Florida may require septic systems to meet stringent water requirements in many drainage basins. If you are planning on having a new septic system installed on your property in Tampa, Florida, knowing the latest requirements for septic systems may make a difference in the type of septic system you choose. While standard septic systems have their own requirements and advantages, a performance-based septic system may be required. At Southern Water and Soil, we will help you decide which performance-based septic system best suits your needs. Some performance-based treatment systems are less costly and offer all the benefits that you need without some of the things you don’t. **Performance-based septic systems** are a little bit different from typical tank and drain field designs because they reduce the amount of space needed for your drain field, while also offering odor-free, neutral septic treatment that doesn’t always require the use of chemicals. Performance-based septic systems may cost a little more than conventional gravity septic systems; however, if water quality standards require a treatment system, then Southern Water and Soil can help with the decision. Performance-based septic systems treat wastewater to a standard that allows for the use of drip irrigation or alternative drainfield products. Finally, these systems can be retrofitted to an existing septic system, making them more convenient additions than having to dig up and reinstall an entirely new system. At Southern Water and Soil, we are experienced at providing our customers with the septic system solutions needed to achieve maximum benefits for their properties. From the initial design to installation and any ongoing maintenance, our team can take care of it all. If you have questions about **performance-based septic systems** and the other system types that are available to you,[ call us](/contact-southern-water-and-soil/) today to discuss your options and to schedule an estimate. We are your top choice for comprehensive septic services in Tampa. --- *At Southern Water and Soil, we install **performance-based septic systems** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-engineering/performance-based-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [**Tampa**](/septic-services-tampa-fl/septic-engineering/performance-based-septic-systems/), [Florida](/residential-septic-florida/septic-engineering/performance-based-septic-systems/).* --- ### [Performance-Based Septic Systems, Florida](https://southernsepticanddesign.com/residential-septic-florida/septic-engineering/performance-based-septic-systems/) **Published:** August 21, 2023 **Author:** Southern Water Soil **Content:** ## Get more out of your wastewater with cutting-edge technology. **![Performance-Based Septic Systems in Florida](/wp-content/uploads/2017/05/performancebasedsepticsystem.jpg)Performance-based septic systems** are intended to make traditional septic systems more efficient and better for the environment. These systems go above and beyond the basic functions of standard septic systems and are especially useful in places where the soil, the size of the site, or the rules and regulations make it hard to build and use standard septic systems correctly. At Southern Water and Soil, our septic engineering team can design a performance-based septic system that meets your needs. The main goal of performance-based septic systems is to treat and handle wastewater in a way that protects the **Florida** environment as much as possible. These systems are made to fit the conditions of each site so that they can adapt better to different soil types, land slopes, and limited room. By doing this, they get around some of the problems with traditional methods. Performance-based septic system benefits include the following: - **Enhanced Treatment Processes.** Unlike traditional septic systems, which depend primarily on anaerobic bacteria to break down waste, performance-based systems use advanced treatment technologies to clean wastewater to a higher level. These technologies include aerobic treatment units, media filters, sand filters that recirculate the sand, built marshes, and others. - **Precise Sizing and Design.** Performance-based systems are designed based on soil type, hydraulic loading rates, site topography, and weather conditions in the area. By considering these things in our design, we ensure the system is big enough to handle the amount of wastewater the property makes. - **Quality of Wastewater.** You might not realize it, but wastewater can be used for a variety of things. In fact, one of the best things about performance-based septic systems is that they can make better-quality wastewater that can be used to water landscapes, golf courses, or even to refill groundwater. - **Long-term Durability.** Performance-based systems are durable, often lasting longer than traditional septic systems if appropriately maintained. **Performance-based septic systems** are a big step forward in treating wastewater. They are more efficient and better for the environment than standard septic systems, and they solve problems caused by different site conditions and rules. [Contact our team](/contact-southern-water-and-soil/) today to learn more about this cutting-edge technology and if it’s right for your property. --- *At Southern Water and Soil, we install **performance-based septic systems** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-engineering/performance-based-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/septic-services-tampa-fl/septic-engineering/performance-based-septic-systems/), [**Florida**](/residential-septic-florida/septic-engineering/performance-based-septic-systems/).* --- ### [Performance-Based Septic Systems, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-engineering/performance-based-septic-systems/) **Published:** April 23, 2023 **Author:** Southern Water Soil **Content:** ## Performance based septic systems offer treatment solutions at affordable costs for homeowners in Dade City. ![Performance-Based Septic Systems in Dade City, Florida](/wp-content/uploads/2017/05/performancebasedsepticsystem.jpg) The State of Florida may require septic systems to meet stringent water requirements in many drainage basins. If you are planning on having a new septic system installed on your property in Dade City, Florida, knowing the latest requirements for septic systems may make a difference in the type of septic system you choose. While standard septic systems have their own requirements and advantages, a performance-based septic system may be required. At Southern Water and Soil, we will help you decide which performance-based septic system best suits your needs. Some performance-based treatment systems are less costly and offer all the benefits that you need without some of the things you don’t. **Performance-based septic systems** are a little bit different from typical tank and drain field designs because they reduce the amount of space needed for your drain field, while also offering odor-free, neutral septic treatment that doesn’t always require the use of chemicals. Performance-based septic systems may cost a little more than conventional gravity septic systems; however, if water quality standards require a treatment system, then Southern Water and Soil can help with the decision. Performance-based septic systems treat wastewater to a standard that allows for the use of drip irrigation or alternative drainfield products. Finally, these systems can be retrofitted to an existing septic system, making them more convenient additions than having to dig up and reinstall an entirely new system. At Southern Water and Soil, we are experienced at providing our customers with the septic system solutions needed to achieve maximum benefits for their properties. From the initial design to installation and any ongoing maintenance, our team can take care of it all. If you have questions about **performance-based septic systems** and the other system types that are available to you,[ call us](/contact-southern-water-and-soil/) today to discuss your options and to schedule an estimate. We are your top choice for comprehensive septic services in Dade City. --- *At Southern Water and Soil, we install **performance-based septic systems** in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/septic-engineering/performance-based-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/septic-services-tampa-fl/septic-engineering/performance-based-septic-systems/), [Florida](/residential-septic-florida/septic-engineering/performance-based-septic-systems/).* --- ### [Passive Nitrogen Septic Systems, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-engineering/passive-nitrogen-septic-systems/) **Published:** August 11, 2017 **Author:** Southern Water Soil **Content:** ## The goal of passive nitrogen septic systems is to reduce the amount of nitrogen that is deposited into the local watersheds in Tampa. ![Passive Nitrogen Septic Systems in Tampa, Florida](/wp-content/uploads/2017/08/septicpumpmaintenance.jpg) At Southern Water and Soil, we work to stay abreast of the latest rules, regulations, and opportunities in the septic industry in Florida. One of the newest studies completed by the State of Florida was a series of tests on **passive nitrogen septic systems** and their effects on the quality of wastewater management and nitrogen removal in local watersheds. The State’s study was based on the information that nitrogen loading from onsite wastewater systems, like those found on most residential properties, is a potential concern in the state. The nitrogen levels and the potential problems created depend on multiple factors, such as the number of onsite installations in a central location, the proximity of the septic system to receiving waters, the sensitivity of receiving waters, and the ability of sub-surface soils to remove nitrogen naturally. **Passive nitrogen septic systems** are of a simpler design than traditional systems, in that they include the use of only one mechanical pump for the entire operation. The goal is to reduce the levels of nitrogen that are deposited into local watersheds. At Southern Water and Soil, we know that having a reliable and efficient septic system at your home or business in Tampa, Florida is critical to the health and safety of your property. That’s why we are able to answer your questions about a variety of septic system options, including performance-based and decentralized septic systems. If you are in a watershed where the nitrogen levels are high, or you would like to investigate whether a passive nitrogen septic system is right for your property, please [contact us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we install **passive nitrogen septic systems** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-engineering/passive-nitrogen-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [**Tampa**](/septic-services-tampa-fl/septic-engineering/passive-nitrogen-septic-systems/), Florida.* --- ### [Passive Nitrogen Septic Systems, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-engineering/passive-nitrogen-septic-systems/) **Published:** April 23, 2023 **Author:** Southern Water Soil **Content:** ## The goal of passive nitrogen septic systems is to reduce the amount of nitrogen that is deposited into the local watersheds in Dade City. ![Passive Nitrogen Septic Systems in Dade City, Florida](/wp-content/uploads/2017/08/septicpumpmaintenance.jpg) At Southern Water and Soil, we work to stay abreast of the latest rules, regulations, and opportunities in the septic industry in Florida. One of the newest studies completed by the State of Florida was a series of tests on **passive nitrogen septic systems** and their effects on the quality of wastewater management and nitrogen removal in local watersheds. The State’s study was based on the information that nitrogen loading from onsite wastewater systems, like those found on most residential properties, is a potential concern in the state. The nitrogen levels and the potential problems created depend on multiple factors, such as the number of onsite installations in a central location, the proximity of the septic system to receiving waters, the sensitivity of receiving waters, and the ability of sub-surface soils to remove nitrogen naturally. **Passive nitrogen septic systems** are of a simpler design than traditional systems, in that they include the use of only one mechanical pump for the entire operation. The goal is to reduce the levels of nitrogen that are deposited into local watersheds. At Southern Water and Soil, we know that having a reliable and efficient septic system at your home or business in Dade City, Florida is critical to the health and safety of your property. That’s why we are able to answer your questions about a variety of septic system options, including performance-based and decentralized septic systems. If you are in a watershed where the nitrogen levels are high, or you would like to investigate whether a passive nitrogen septic system is right for your property, please [contact us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we install **passive nitrogen septic systems** in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/septic-engineering/passive-nitrogen-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/septic-services-tampa-fl/septic-engineering/passive-nitrogen-septic-systems/), Florida.* --- ### [Engineered Drip Septic Systems, Florida](https://southernsepticanddesign.com/residential-septic-florida/septic-engineering/engineered-drip-septic-systems/) **Published:** April 18, 2024 **Author:** Southern Water Soil **Content:** ## Our professional team can expertly install engineered drip septic systems on your property. ![Engineered Drip Septic Systems in Florida](/wp-content/uploads/2021/11/2013-08-24-13.45.40-300x169.jpg)We at Southern Water and Soil have been working in the septic industry for over 30 years, so we are familiar with all types of septic systems. One type of system we would like to highlight here is **engineered drip septic systems**. Instead of letting effluent flow continuously, engineered drip septic systems are designed to release smaller amounts (or “drips”) of effluent at a time at regular intervals, which reduces the risk of the system overflowing. By holding effluent back until it is time to release the next drip, these systems treat the wastewater more effectively while preventing untreated waste from getting into the soil. Engineered drip septic systems are ideal for use in places where a traditional septic trench would be hard to install, such as areas with a steep slope or a forested environment. They are also great for facilities which are only open during warmer months, such as resorts or golf courses. Furthermore, these systems can be combined with pretreatment systems, such as sand filters or aerobic septic systems, to add another layer of protection for your property. Our team is proud to serve the great state of **Florida**, and we want to help all our clients take care of their sewage management needs. If you are interested in learning more about **engineered drip septic systems**, we encourage you to [give us a call](/contact-southern-water-and-soil/) to get more information. We would be more than happy to answer any questions you may have or help you schedule a consultation with a team member. --- *At Southern Water and Soil, we install **engineered drip septic systems** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-engineering/engineered-drip-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/engineered-drip-septic-systems/), Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/residential-septic-tampa-fl/septic-engineering/engineered-drip-septic-systems/), **[Florida](/residential-septic-florida/septic-engineering/engineered-drip-septic-systems/)**.* --- ### [Engineered Drip Septic Systems, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-engineering/engineered-drip-septic-systems/) **Published:** November 16, 2021 **Author:** Southern Water Soil **Content:** ## Engineered drip septic systems reduce the risk of untreated wastewater. ![Engineered Drip Septic Systems in Tampa, Florida](/wp-content/uploads/2021/11/2013-08-24-13.45.40.jpg)When it comes to septic system types, you have many options to pick from. One of these is an engineered drip septic system, which releases small amounts or “drips” of wastewater at consistent intervals. **Engineered drip septic systems** minimize the risk of untreated wastewater getting into the soil while maximizing the treatment of wastewater. At Southern Water and Soil, we recommend the installation of **engineered drip septic systems** in places with forested areas, steep slopes, and other areas where a trench could be hard to install. These septic systems are also a good fit for resorts and golf courses that are only open during the warmer months of the year here in **Tampa, Florida**. We often combine engineered drip septic systems with a pretreatment system, such as a sand filter or an aerobic septic system. Engineered drip septic systems are comprised of three separate parts: 1. The dispersal unit. This is comprised of a return line and a supply line. 2. The septic tank. 3. The lift tank. This contains a pump and a filter. These two parts work together to distribute wastewater evenly throughout the soil and the tubing. If you are interested in installing an engineered drip septic system on your property, our highly qualified, experienced team can help with the permitting, design, and installation processes. To set up a site evaluation or to learn more about engineered drip septic systems, [contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **engineered drip septic systems** in Brooksville, [Dade City](/residential-septic-dade-city-fl/septic-engineering/engineered-drip-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/engineered-drip-septic-systems/), Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and **[Tampa](/residential-septic-tampa-fl/septic-engineering/engineered-drip-septic-systems/)**, [Florida](/residential-septic-florida/septic-engineering/engineered-drip-septic-systems/).* --- ### [Engineered Drip Septic Systems, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-engineering/engineered-drip-septic-systems/) **Published:** April 23, 2023 **Author:** Southern Water Soil **Content:** ## Engineered drip septic systems reduce the risk of untreated wastewater. ![Engineered Drip Septic Systems in Dade City, Florida](/wp-content/uploads/2021/11/2013-08-24-13.45.40.jpg)When it comes to septic system types, you have many options to pick from. One of these is an engineered drip septic system, which releases small amounts or “drips” of wastewater at consistent intervals. **Engineered drip septic systems** minimize the risk of untreated wastewater getting into the soil while maximizing the treatment of wastewater. At Southern Water and Soil, we recommend the installation of **engineered drip septic systems** in places with forested areas, steep slopes, and other areas where a trench could be hard to install. These septic systems are also a good fit for resorts and golf courses that are only open during the warmer months of the year here in **Dade City, Florida**. We often combine engineered drip septic systems with a pretreatment system, such as a sand filter or an aerobic septic system. Engineered drip septic systems are comprised of three separate parts: 1. The dispersal unit. This is comprised of a return line and a supply line. 2. The septic tank. 3. The lift tank. This contains a pump and a filter. These two parts work together to distribute wastewater evenly throughout the soil and the tubing. If you are interested in installing an engineered drip septic system on your property, our highly qualified, experienced team can help with the permitting, design, and installation processes. To set up a site evaluation or to learn more about engineered drip septic systems, [contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **engineered drip septic systems** in Brooksville, **[Dade City](/residential-septic-dade-city-fl/septic-engineering/engineered-drip-septic-systems/)**, Fort Myers, Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/engineered-drip-septic-systems/), Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/residential-septic-tampa-fl/septic-engineering/engineered-drip-septic-systems/), [Florida](/residential-septic-florida/septic-engineering/engineered-drip-septic-systems/).* --- ### [Septic Engineering, Florida](https://southernsepticanddesign.com/residential-septic-florida/septic-engineering/) **Published:** August 21, 2023 **Author:** Southern Water Soil **Content:** ## Our experienced team can help you with the design of your septic system. **Septic engineering** is a subfield of civil and environmental engineering that focuses on designing, building, operating, and maintaining on-site wastewater treatment systems or septic systems. These systems are used where centralized sewer systems cannot clean and remove wastewater from **Florida** homes. At Southern Water and Soil, we have over 30 years of experience in the septic industry and can assist you in designing your residential or commercial system. ![Septic Engineering](/wp-content/uploads/2026/05/20140109_112309-res.jpg) When you call our septic engineering team, we will conduct a site evaluation to determine the best design for your septic system using data about topography, hydrogeology, and more. A good site evaluation ensures the system works well and doesn’t put your property at risk. After evaluating the site, our septic engineers will create a system that matches your property’s wastewater output and the soil’s ability to absorb water. Considerations include the number of people living on or using the site, how much water they use, and how well the soil drains. Our team follows all local, state, and federal rules when designing septic systems. We take our role in septic engineering seriously, so we make sure we’re current on any laws and regulations we need to follow. Our team will closely monitor the installation, keeping an eye on how the various pieces come together, how the pipes are connected, and how the backfilling is done. Additionally, we will provide you with maintenance information since a septic system will last longer and work better if it’s well managed. [Contact us today](/contact-southern-water-and-soil/) if you need an experienced **septic engineering** team. We can evaluate your needs and develop a plan so that you can feel confident in the finished product. --- *At Southern Water and Soil, we offer **septic engineering** services in [Brooksville](/residential-septic-brooksville-fl/septic-engineering/), [Dade City](/residential-septic-dade-city-fl/septic-engineering/), [Fort Myers](/residential-septic-fort-myers-fl/septic-engineering/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/), [Odessa](/septic-services-odessa-fl/septic-engineering/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-engineering/), and [Tampa](/septic-services-tampa-fl/septic-engineering/), [**Florida**](/residential-septic-florida/septic-engineering/).* ### Similar Services We Offer: --- ### [Septic Engineering, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/septic-engineering/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Excerpt:** Septic tanks are common throughout rural areas, since they provide a practical solution for homes and offices that are far away from waste processing facilities. At Southern Water & Soil, we offer septic engineering to build and install the perfect septic system for your residential or commercial property in the Tampa, FL area. **Content:** ## Our septic engineering experts can create the perfect system that will accommodate the needs of your Tampa, FL property. Septic tanks are common throughout Florida, since they provide a solution for homes and offices that do not have access to waste processing facilities. At Southern Water & Soil, we offer **septic engineering** to build and install the perfect septic system for your residential or commercial property in the **Tampa, FL** area. We have licensed engineers on staff who have experience and knowledge in the design and creation of septic tanks. ![Septic Engineering](/wp-content/uploads/2026/05/20140109_112309-res.jpg) The main reason that you may want to hire us for **septic engineering** services is so that you can get a septic system that fits with your needs. If you have a large office building that will be handling a lot of waste and water, we can design a system that can easily handle that. We can also work with farmers and those with large properties to create drip irrigation systems, aerobic treatment systems, or a system that uses a pump where a gravity-fed system is not an option. In Florida, state law requires that an engineer design any septic drain field that measures 1,000 square feet or more. Additionally, an engineer must design any drip irrigation system that is in use, so if you are looking to add something different to your septic system, give us a call. Our septic engineering experts can create the perfect system that will accommodate the needs of your property, whether for the comfort of your family or employees, or to ensure that every plant in your garden receives enough water. For more information, [contact us](/contact-southern-water-and-soil/ "septic systems experts") today! --- *At Southern Water and Soil, we offer **septic engineering** services in [Brooksville](/residential-septic-brooksville-fl/septic-engineering/), [Dade City](/residential-septic-dade-city-fl/septic-engineering/), [Fort Myers](/residential-septic-fort-myers-fl/septic-engineering/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/), [Odessa](/septic-services-odessa-fl/septic-engineering/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-engineering/), and **[Tampa](/septic-services-tampa-fl/septic-engineering/)**, [Florida](/residential-septic-florida/septic-engineering/).* ### Similar Services We Offer: --- ### [Septic Engineering, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/septic-engineering/) **Published:** May 5, 2024 **Author:** Southern Water Soil **Content:** ## Our team has the right experience to handle all your septic engineering needs. At its core, the whole field of engineering exists to solve problems, and all the subfields focus on different kinds of problems. One of the most pressing problems people face when building new housing developments, businesses, or other structures is how to deal with sewage and waste, and the field of **septic engineering** exists to provide solutions to these issues. Our team at Southern Water and Soil has extensive experience in septic engineering, and you can turn to us whenever you need help dealing with waste on your property. ![Septic Engineering](/wp-content/uploads/2026/05/20140109_112309-res.jpg) When you turn to us for septic engineering services, we will first assess your property and its needs to determine the best approach. Not all properties are suited for a traditional septic system, so we might need to use an alternative solution. No matter what, we’ll make sure to design a system that reliably meets your property’s treatment needs. Once we have finalized the design, our team will get to work on the installation process, taking care of all excavation, installation, and cleanup. We are confident you will be more than satisfied with our results, and we encourage you to take advantage of our septic engineering services. To learn more about what we can do for you, simply contact our team. We are proud to serve the **Spring Hill, Florida** area, and we want to help you take care of all your septic needs. If you are looking for experienced **septic engineering** specialists you can count on to deliver outstanding results, just [give us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic engineering** services in [Brooksville](/residential-septic-brooksville-fl/septic-engineering/), [Dade City](/residential-septic-dade-city-fl/septic-engineering/), [Fort Myers](/residential-septic-fort-myers-fl/septic-engineering/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/), [Odessa](/septic-services-odessa-fl/septic-engineering/), Orlando, Plant City, [**Spring Hill**](/residential-septic-spring-hill-fl/septic-engineering/), and [Tampa](/septic-services-tampa-fl/septic-engineering/), [Florida](/residential-septic-florida/septic-engineering/).* --- ### [Septic Engineering, Odessa, FL](https://southernsepticanddesign.com/residential-septic-odessa-fl/septic-engineering/) **Published:** August 12, 2015 **Author:** Southern Water Soil **Content:** ## We provide septic engineering services in the Odessa, FL area and can build and install the perfect system for your property. If you don’t have access to a waste processing facility, you may have considered having a septic system installed on your property. However, since your property is unique, you need a team that can engineer a system that accounts for your property’s specific features. This is where our team at Southern Water and Soil comes in. We provide **septic engineering** services in the **Odessa, Florida** area and can build and install the perfect system for your property. ![Septic Engineering](/wp-content/uploads/2026/05/20140109_112309-res.jpg) When you turn to us to take advantage of our septic engineering services, our licensed engineers will rely on their experience and knowledge in the septic industry to create a functional, efficient system for you. However, the main reason why you should let us take over your septic system creation project is because we are committed to ensuring that your system meets your specific needs. For example, if you run a large commercial building that handles a lot of waste and water every day, we can devise a system for you that will easily handle this situation. In addition to creating new septic systems, our **septic engineering** experts can also help you add something different to your septic system. For example, if you are interested in equipping your property with a drip irrigation system, we are the ones for the job. If you have any questions about our septic engineering services and why you should let us at Southern Water and Soil meet all of your property’s septic needs, please don’t hesitate to [reach out to us](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic engineering** services in [Brooksville](/residential-septic-brooksville-fl/septic-engineering/), [Dade City](/residential-septic-dade-city-fl/septic-engineering/), [Fort Myers](/residential-septic-fort-myers-fl/septic-engineering/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/), **[Odessa](/septic-services-odessa-fl/septic-engineering/)**, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-engineering/), and [Tampa](/septic-services-tampa-fl/septic-engineering/), [Florida](/residential-septic-florida/septic-engineering/).* --- ### [Septic Engineering, Miami, FL](https://southernsepticanddesign.com/residential-septic-miami-fl/septic-engineering/) **Published:** May 28, 2023 **Author:** Southern Water Soil **Content:** ## Septic engineering is more than digging a hole and installing a tank. **Septic engineering** may not be the most glamorous of topics. Still, it’s undeniably crucial for the successful functionality of homes and businesses alike, especially those outside the reach of municipal sewer systems. At Southern Water and Soil, we’ve been serving the **Miami, Florida** community with top-tier septic engineering solutions for many years, and we understand the ins and outs of this industry better than most. ![Septic Engineering](/wp-content/uploads/2026/05/20140109_112309-res.jpg) Our **septic engineering** is more than digging a hole and installing a tank. It’s a meticulously planned process that begins with an in-depth assessment of your property, its soil conditions, and its specific needs. We understand every site is unique, so we tailor our design and implementation strategies to suit your specific requirements perfectly. Our innovative nitrogen-reducing systems and septic-to-sewer conversions testify to our commitment to protecting Florida’s precious water resources. Nitrogen-reducing septic systems are onsite wastewater treatment systems that can lower the amount of nitrogen in the effluent, or wastewater. Nitrogen is a nutrient that can cause eutrophication and harm aquatic ecosystems, but nitrogen-reducing septic tanks use different methods to remove or transform nitrogen, such as nitrification, denitrification, or anammox. But our job doesn’t end at installation. We build long-lasting relationships with our clients by offering comprehensive maintenance and prompt repair services. We aim to ensure your system continues to function smoothly, offering you peace of mind and saving you from potential inconveniences in the future. In addition, we take it upon ourselves to educate our clients about their septic systems. Let us help you with your septic system project. [Contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic engineering** services in [Brooksville](/residential-septic-brooksville-fl/septic-engineering/), [Dade City](/residential-septic-dade-city-fl/septic-engineering/), [Fort Myers](/residential-septic-fort-myers-fl/septic-engineering/), Land O’ Lakes, Lutz, **[Miami](/residential-septic-miami-fl/septic-engineering/)**, [Odessa](/septic-services-odessa-fl/septic-engineering/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-engineering/), and [Tampa](/septic-services-tampa-fl/septic-engineering/), [Florida](/residential-septic-florida/septic-engineering/).* ### Similar Services We Offer: --- ### [Septic Engineering, Fort Meyers, FL](https://southernsepticanddesign.com/residential-septic-fort-myers-fl/septic-engineering/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## Our team is here to take care of all your septic engineering needs. Much like law, engineering is a broad field that encompasses many subfields. Because the field contains so much, no engineer can master every discipline in it; instead, they must choose specific specializations. For example, electrical engineers design electrical systems, while civil engineers build roads and other infrastructure. The type of engineering we at Southern Water and Soil specialize in is far from glamorous, but it is extremely necessary. Simply put, we focus on **septic engineering**. If you need someone with the right knowledge and experience to design a septic system for your business, development, or other project, reach out to us today. ![Septic Engineering](/wp-content/uploads/2026/05/20140109_112309-res.jpg) We have been working in septic engineering for over 30 years, so you can count on us to get the job done right. Our team has worked with clients in all kinds of industries, designing septic systems for everything from manufacturing plants to storefronts and more. When you choose us as your septic engineering firm, we’ll make sure to get every detail of the designs for your system just right, and we’ll take care of the installation process for you as well. From securing the initial permits to connecting the finished system to your pipes, our team has you covered. Our team is proud to serve the **Fort Meyers, Florida** area, and we want to help you with all your **septic engineering** needs. If you are looking for a team you can trust to design and build a robust septic system for your property or development, just [give us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **septic engineering** services in [Brooksville](/residential-septic-brooksville-fl/septic-engineering/), [Dade City](/residential-septic-dade-city-fl/septic-engineering/), [**Fort Myers**](/residential-septic-fort-myers-fl/septic-engineering/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/), [Odessa](/septic-services-odessa-fl/septic-engineering/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-engineering/), and [Tampa](/septic-services-tampa-fl/septic-engineering/), [Florida](/residential-septic-florida/septic-engineering/).* --- ### [Septic Engineering, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/septic-engineering/) **Published:** November 2, 2023 **Author:** Southern Water Soil **Content:** ## Before starting a septic engineering project, we’ll carefully inspect every area of your property. At Southern Water and Soil, we’re proud to be a leading provider of septic services in and around **Brooksville, Florida**. Our team has over three decades of combined experience in both the commercial and residential septic industry, making us the best choice when you need any type of septic service. ![Septic Engineering](/wp-content/uploads/2026/05/20140109_112309-res.jpg) One of our main areas of expertise is **septic engineering**, which refers to the process of designing and constructing systems on different types of properties. Whether we’re designing a new system as part of a construction project or replacing your current components, you can count on us to do the job efficiently and correctly. Before beginning a septic engineering project, we’ll carefully assess every aspect of your property. This meticulous first step ensures that we incorporate elements that are best suited to the design and layout of your space. Additionally, we can include nitrogen-reducing components that are designed to minimize an excess of this gas in the wastewater, which can help protect the surrounding environment. By taking a customized approach to every **septic engineering** task, we’re able to install a system that suits the property best. We can include alternative elements, such as lift stations and grease traps, to ensure the best performance. In addition to offering septic design and installation services, we can help care for systems that have already been installed, whether we handled the work or not. You can rely on our trained technicians to perform repairs, maintenance, and cleaning and pumping services to keep things flowing smoothly. [Reach out to us](/contact-southern-water-and-soil/) to learn more or request an estimate. --- *At Southern Water and Soil, we offer **septic engineering** services in [**Brooksville**](/residential-septic-brooksville-fl/septic-engineering/), [Dade City](/residential-septic-dade-city-fl/septic-engineering/), [Fort Myers](/residential-septic-fort-myers-fl/septic-engineering/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/), [Odessa](/septic-services-odessa-fl/septic-engineering/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-engineering/), and [Tampa](/septic-services-tampa-fl/septic-engineering/), [Florida](/residential-septic-florida/septic-engineering/).* --- ### [Onsite Sewage Treatment and Disposal Systems, Florida](https://southernsepticanddesign.com/residential-septic-florida/onsite-sewage-treatment-and-disposal-systems/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## Onsite waste disposal is perfect for more rural or isolated areas. There are many areas across the state of **Florida** that don’t have the same access to municipal sewage treatment that other locations have. For these properties, **onsite sewage treatment and disposal systems** offer many benefits. They allow property owners to safely dispose of the waste accumulated on their property without relying on the city; all they need is a qualified septic system company to provide this system with expert workmanship. ![Onsite Sewage Treatment and Disposal Systems in Florida](/wp-content/uploads/2024/07/IMAG1003res.jpg) Here at Southern Water and Soil, we provide septic solutions to all of our clients looking at onsite sewage treatment and disposal systems for their property. There are many reasons why these systems are preferable to city waste management solutions, including working around the limited access to traditional city systems for people living in more rural or isolated areas. Our engineered septic systems are designed to work with a property owner’s available land, requirements for waste management, and other factors. We’ll talk with you about designing a septic system that will suit all of your needs while adhering to all codes and regulations for the area. Designing and installing **onsite sewage treatment and disposal systems** is what our team does best, and we’re experts in modern septic services and technologies. You can trust us to engineer a system that is long-lasting and tailored to what you’re looking for in a septic system. If you’re looking for onsite sewage treatment solutions due to living in a remote location or you simply prefer these systems to city sewage systems, don’t hesitate to give our team of septic professionals a [call today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **onsite sewage treatment and disposal systems** in [Brooksville](/residential-septic-brooksville-fl/onsite-sewage-treatment-and-disposal-systems/), [Dade City](/residential-septic-dade-city-fl/onsite-sewage-treatment-and-disposal-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [**Florida**](/residential-septic-florida/onsite-sewage-treatment-and-disposal-systems/).* --- ### [Onsite Sewage Treatment and Disposal Systems, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/onsite-sewage-treatment-and-disposal-systems/) **Published:** January 20, 2025 **Author:** Southern Water Soil **Content:** ## Our team is prepared to handle onsite sewage treatment and disposal systems. Residential properties in **Brooksville, Florida** require effective waste disposal, and this is something our team can provide at Southern Water and Soil. With three decades of experience in our industry, we are prepared to design and install the system you need. ![Onsite Sewage Treatment and Disposal Systems in Brooksville, Florida](/wp-content/uploads/2024/07/IMAG1003res.jpg) **Onsite sewage treatment and disposal systems** (OSTDS), colloquially known as septic systems, offer a reliable waste disposal solution for properties where connecting to a sewage system is unfeasible. Many homes in rural areas rely on septic systems because they cannot access a municipal sewage system, for example. There are many different types of **onsite sewage treatment and disposal systems**, but they share common design features that perform essential processes. For example, they each have a septic tank. This is where waste separates into layers. Solids sink to the bottom to form sludge, while oils, fats, and grease rise to the top, creating scum. The liquid effluent is treated by anaerobic (and sometimes aerobic) bacteria and then sent to a drain field where the treated wastewater percolates through perforated pipes and the soil for further treatment by natural processes. If your home or residential property in Brooksville requires an OSTDS, you can count on our septic experts to handle its design and installation. We will carefully survey your property and create a design that accounts for its unique features, geographical and otherwise. Then we will ensure the system is installed with attention to detail. [Contact us today](/contact-southern-water-and-soil/) to learn more about onsite sewage treatment and disposal systems. --- *At Southern Water and Soil, we install **onsite sewage treatment and disposal systems** in [**Brooksville**](/residential-septic-brooksville-fl/onsite-sewage-treatment-and-disposal-systems/), [Dade City](/residential-septic-dade-city-fl/onsite-sewage-treatment-and-disposal-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/onsite-sewage-treatment-and-disposal-systems/).* --- ### [Onsite Sewage Treatment and Disposal Systems, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/onsite-sewage-treatment-and-disposal-systems/) **Published:** July 8, 2025 **Author:** Southern Water Soil **Content:** ## We design, install, and care for onsite sewage treatment and disposal systems. One of our specialties at Southern Water and Soil involves the design, installation, and ongoing care of onsite sewage treatment and disposal systems. Whether you are building a new home, renovating an existing property, or upgrading to meet today’s environmental standards, we offer complete services that can be customized to your specific site in **Dade City, Florida** and your needs. ![Onsite Sewage Treatment and Disposal Systems in Dade City, Florida](/wp-content/uploads/2025/07/IMAG1003-res.jpg) **Onsite sewage treatment and disposal systems** are crucial components of properties that are not connected to municipal sewer lines. These systems are designed to collect, treat, and disperse wastewater right on your property, protecting both your health and the health of the surrounding environment. When you turn to us for help with a project, we will start off with a detailed site evaluation. This process lets us determine your soil type, water table depth, and property layout. From there, we can custom design a wastewater system that complements your needs, whether we recommend a conventional septic system or an advanced treatment unit for a more complex site. Our team handles every step of the process, from soil testing and system design to permitting and beyond. We only use the highest quality materials when designing, building, or repairing **onsite sewage treatment and disposal systems** to ensure reliability and durability. We don’t believe in one-size-fits-all solutions, and we take pride in offering systems that are thoughtfully engineered for lasting performance. [Contact us today](/contact-southern-water-and-soil/) to discuss your upcoming septic service project and to learn more about the services we offer for onsite sewage treatment and disposal systems. --- *At Southern Water and Soil, we install **onsite sewage treatment and disposal systems** in [Brooksville](/residential-septic-brooksville-fl/onsite-sewage-treatment-and-disposal-systems/), **[Dade City](/residential-septic-dade-city-fl/onsite-sewage-treatment-and-disposal-systems/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/onsite-sewage-treatment-and-disposal-systems/).* --- ### [Onsite Sewage Treatment and Disposal System Conversions, Miami, FL](https://southernsepticanddesign.com/residential-septic-miami-fl/onsite-sewage-treatment-and-disposal-system-conversions/) **Published:** May 28, 2023 **Author:** Southern Water Soil **Content:** ## We make switching from septic to sewer systems easy. Wastewater management is a vital aspect of urban development and environmental protection. It ensures that the water we use for various purposes is properly treated and disposed of, preventing pollution and health hazards. At Southern Water and Soil, we are committed to providing effective and sustainable solutions for wastewater management. One of our main services is **onsite sewage treatment and disposal system conversions**. Essentially, we help you replace your septic system by connecting your property to the public sewer system. ![Onsite Sewage Treatment and Disposal System Conversions, Miami, Florida](/wp-content/uploads/2020/08/2011-08-04-11.36-res.jpg) Septic systems are onsite sewage treatment and disposal systems commonly used in rural or remote areas where public sewers are not accessible. They consist of a tank and a drain field that treat and disperse wastewater into the soil. **Onsite sewage treatment and disposal system conversions** not only mitigate risks but also enhance the efficiency and reliability of wastewater management, benefiting both property owners and the environment. Our team ensures a smooth and efficient switching process. We begin with a comprehensive property assessment. Then we handle all necessary permits and coordinate with local authorities to ensure compliance with regulations. Once the groundwork is complete, our skilled technicians connect your property to the public sewage system with precision and care, ensuring minimal disruption to your daily life. We are proud to offer onsite sewage treatment and disposal system conversions. [Choose us to handle your needs](/contact-southern-water-and-soil/) and take a significant step towards a more sustainable and resilient community in **Miami, Florida**. We look forward to discussing and fulfilling your needs. --- *At Southern Water and Soil, we perform **onsite sewage treatment and disposal system conversions** in Brooksville, [Dade City](/residential-septic-dade-city-fl/onsite-sewage-treatment-and-disposal-system-conversions/), Fort Myers, Land O’ Lakes, Lutz, **[Miami](/residential-septic-miami-fl/onsite-sewage-treatment-and-disposal-system-conversions/)**, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/onsite-sewage-treatment-and-disposal-system-conversions/).* --- ### [Onsite Sewage Treatment and Disposal System Conversions, Florida](https://southernsepticanddesign.com/residential-septic-florida/onsite-sewage-treatment-and-disposal-system-conversions/) **Published:** April 18, 2024 **Author:** Southern Water Soil **Content:** ## You can count on us to handle all your onsite sewage treatment and disposal system conversions. Our team at Southern Water and Soil has over three decades of professional experience in the water and sewage treatment industry. We understand that different properties and communities require unique solutions, and you can count on us to help you find the best option for your specific needs. For example, we have the right knowledge and skills to handle even the most complex **onsite sewage treatment and disposal system conversions**. ![Onsite Sewage Treatment and Disposal System Conversions in Florida](/wp-content/uploads/2020/08/2011-08-04-11.36-res.jpg) When you turn to us for help with onsite sewage treatment and disposal system conversions, you can rest assured that we will design everything according to the latest industry standards and environmental regulations. Our team works closely with regulatory agencies to ensure that our sewage treatment systems are as environmentally friendly as possible, and we are committed to upholding the highest standards of quality and precision in our work. We are eager to use our skills to make your conversion project a success. We have been proudly serving the state of **Florida** for over 30 years, and we have the right knowledge and experience to tackle your **onsite sewage treatment and disposal system conversions**. Our team will thoroughly assess your property and its existing septic system to determine what changes need to be made, and we’ll design your new system to deliver optimal performance. When designing system conversions, we make sure to consider your property size, soil type, local regulations, and all other pertinent factors to create the ideal solution for your needs. Then, our team will get to work on converting your system, and we’ll take care of all necessary cleanup afterwards. Please [connect with us](/contact-southern-water-and-soil/) today to learn more about our services. --- *At Southern Water and Soil, we perform **onsite sewage treatment and disposal system conversions** in Brooksville, [Dade City](/residential-septic-dade-city-fl/onsite-sewage-treatment-and-disposal-system-conversions/), Fort Myers, Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/onsite-sewage-treatment-and-disposal-system-conversions/), Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [**Florida**](/residential-septic-florida/onsite-sewage-treatment-and-disposal-system-conversions/).* --- ### [Onsite Sewage Treatment and Disposal System Conversions, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/onsite-sewage-treatment-and-disposal-system-conversions/) **Published:** May 28, 2023 **Author:** Southern Water Soil **Content:** ## We focus on effective designs for sewage treatment and disposal. At Southern Water and Soil, we understand the importance of functional and efficient sewage treatment and disposal in **Dade City, Florida**. Our highly cross-trained professionals are well versed in **onsite sewage treatment and disposal system conversions**, and they provide services that exceed our customers’ expectations. ![Onsite Sewage Treatment and Disposal System Conversions in Dade City, Florida](/wp-content/uploads/2020/08/2011-08-04-11.36-res.jpg) Our approach incorporates the latest industry standards. We focus on cost-effective, environmentally friendly designs tailored to your property’s unique needs. We also work closely with regulatory agencies, ensuring all necessary approvals are obtained and your system meets the most rigorous standards. Our commitment to quality, precision, and customer satisfaction has positioned us as a leader in **onsite sewage treatment and disposal system conversions**. We are eager to apply our skills and expertise to provide your property with a seamless and efficient conversion. With over 30 years of combined experience in the septic industry, we have plenty of expertise in onsite sewage treatment and disposal system conversions. Our team begins by evaluating the current septic system and identifying any issues that need addressing. We then develop a customized plan, considering soil type, property size, and local regulations. Our team ensures that the new system is designed and installed with minimal headaches, providing peace of mind that your property’s wastewater management is in the hands of experts. Furthermore, we believe in educating our clients on the importance of proper maintenance and care for their onsite sewage treatment and disposal systems. By maintaining your system well, you can prevent costly repairs down the line and ensure the longevity of your investment. [Choose us](/contact-southern-water-and-soil/) for your conversion needs and experience the difference of working with a company that puts you first. --- *At Southern Water and Soil, we perform **onsite sewage treatment and disposal system conversions** in Brooksville, **[Dade City](/residential-septic-dade-city-fl/onsite-sewage-treatment-and-disposal-system-conversions/)**, Fort Myers, Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/onsite-sewage-treatment-and-disposal-system-conversions/), Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/residential-septic-florida/onsite-sewage-treatment-and-disposal-system-conversions/).* --- ### [Lift Station Pump Replacement, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/lift-stations/lift-station-pump-replacement/) **Published:** May 21, 2025 **Author:** Southern Water Soil **Content:** ## Our professional crew can efficiently replace your system’s lift station pump. There are several properties throughout the **Dade City, Florida** region that feature private septic systems, but not all landscapes are conducive to gravity-fed systems. In some cases, property owners need to incorporate lift stations into their septic systems to efficiently pump wastewater to an elevated area. However, when lift station pumps stop working properly or become too worn out to do their job anymore, they’ll need to be promptly replaced to keep things running smoothly. ![Lift Station Pump Replacement in Dade City, Florida](/wp-content/uploads/2025/05/2012-01-26-13.06.02-res.jpg) Here at Southern Water and Soil, our team is proud to have over 30 years of combined experience in the septic industry, and we’re fully equipped to handle your **lift station pump replacement** needs. Our knowledgeable technicians will carefully assess your entire septic system, inspect the condition of your lift station pump, and determine if lift station pump replacement services are right for your unique situation. If we can effectively repair the pump, we’ll apply the necessary fixes and get things back up and running in no time. Sometimes, our clients ask us how they can tell if they need lift station pump replacement services, and we always say that there are a few key things they should look out for. If you notice any of the following signs, give us a call for **lift station pump replacement** right away: - Slow drains - Unpleasant odors around the property - Pooling or standing water - Leaking water around the lift station - Constant pump cycling For more information about our services, don’t hesitate to [reach out to our team today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **lift station pump replacement** services in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/lift-stations/lift-station-pump-replacement/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Lift Station Pump Repair, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/lift-stations/lift-station-pump-repair/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## You can count on us to restore your lift station pump to good working order. Most septic systems are designed to use gravity to keep the effluent flowing into the tank and then into the drain field. In other words, the tank is downhill of the building it serves, and the drain field is downhill of the tank. On some properties, though, it is not possible to arrange the parts of the system like this, and one piece needs to be uphill of another. In these situations, septic companies like ours at Southern Water and Soil use lift station pumps to move the effluent in the correct direction. Our team has over 30 years of experience in the septic industry, and we offer a comprehensive range of services to keep your system, including the lift stations, in good condition. If you need **lift station pump repair**, don’t hesitate to give us a call. ![Lift Station Pump Repair in Tampa, Florida](/wp-content/uploads/2024/10/timedosecontrol_res.jpg) When you call our team for **lift station pump repair**, we will first inspect the station to determine what is causing the problem. In some cases, we might need to replace a part of the pump mechanism or even the whole pump. No matter what, though, we will make sure your lift station is restored to excellent condition so it can continue to do its very important job. We are proud to serve the **Tampa, Florida** area, and we want to help you keep your septic system in good working order. If you have been having problems with your lift station, we encourage you to [give us a call](/contact-southern-water-and-soil/) to schedule lift station pump repair as soon as possible. --- *At Southern Water and Soil, we offer **lift station pump repair** services in Brooksville, [Dade City](/residential-septic-dade-city-fl/lift-stations/lift-station-pump-repair/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and **[Tampa](/residential-septic-tampa-fl/lift-stations/lift-station-pump-repair/)**, Florida.* --- ### [Lift Station Pump Repair, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/lift-stations/lift-station-pump-repair/) **Published:** December 17, 2024 **Author:** Southern Water Soil **Content:** ## We can help you when your lift station breaks down. A lift station is a critical component of any wastewater or sewage system, and it is primarily used to move sewage from a lower elevation to a higher one when gravity alone cannot facilitate the flow. Most lift stations include a pumping station equipped with one or more pumps that lift the wastewater to a higher point in the system, allowing it to continue its journey toward your septic tank. ![Lift Station Pump Repair in Dade City, Florida](/wp-content/uploads/2024/10/timedosecontrol_res.jpg) If something goes wrong with your lift station, your entire septic system could be in trouble. When you need **lift station pump repair**, it’s essential to turn to a professional right away to take care of the problem and have it fixed. At Southern Water and Soil, we can diagnose your lift station and recommend the steps you should take next. There are many different reasons why you could be in need of lift station pump repair. For example, over time, the pumps in your lift station can wear out due to constant use, leading to decreased performance or complete failure. These pumps are also prone to electrical or mechanical problems that can cause the pump to stop functioning. Non-biodegradable materials, like rags, plastics, and wipes can also accumulate in your lift station, blocking pipes, pumps, or valves, and leading to the station not functioning. When you need **lift station pump repair** in the **Dade City, Florida** area, [contact us](/contact-southern-water-and-soil/), and we can refer you to one of our carefully vetted partners who will take over the job. --- *At Southern Water and Soil, we offer **lift station pump repair** services in Brooksville, [**Dade City**](/residential-septic-dade-city-fl/lift-stations/lift-station-pump-repair/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/residential-septic-tampa-fl/lift-stations/lift-station-pump-repair/), Florida.* --- ### [Lift Station Pump Installation, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/lift-stations/lift-station-pump-installation/) **Published:** May 28, 2023 **Author:** Southern Water Soil **Content:** ## You can trust us to provide lift station pump installation. Lift stations are essential to many septic and sewer systems, especially in areas where the natural topography doesn’t allow for gravity-fed systems. Lift stations pump wastewater from lower to higher elevations, ensuring the wastewater moves smoothly through your system and reaches the treatment facility without any issues. We are a **lift station pump installation** service provider with a team of professionals who understand the critical role that lift stations play in maintaining reliable wastewater management systems. ![Lift Station Pump Installation in Dade City, Florida](/wp-content/uploads/2023/03/septicsystemwarrantypackagesres.jpg) At Southern Water and Soil, we offer thorough **lift station pump installation** services, from initial site assessment and design to installation and testing. Our installation begins with a detailed site evaluation to determine your lift station’s best location and design. We consider the size and type of your wastewater system, the volume of wastewater to be handled, and the specific characteristics of your property. We then design a lift station optimized for your system, incorporating the best pumps and other components to ensure reliable and efficient operation. Once the design phase is completed, our skilled technicians proceed with the installation, adhering to strict quality and safety standards. We understand that the successful operation of your wastewater system heavily relies on the correct installation of the lift station pump, so we work with precision. You can trust us for all your lift station pump installation needs. With our commitment to excellence, customer-focused approach, and extensive industry experience, we are the solution for all your septic design, engineering, installation, repair, and maintenance needs in **Dade City, Florida**. [Contact us today](/contact-southern-water-and-soil/) to discuss your project. --- *At Southern Water and Soil, we offer **list station pump installation** services in Brooksville, **[Dade City](https://southernsepticanddesign.com/residential-septic-dade-city-fl/lift-stations/lift-station-pump-installation/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Lift Stations, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/lift-stations/) **Published:** August 1, 2024 **Author:** Southern Water Soil **Content:** ## It’s important to choose the right team for all your septic system needs. Lift stations are critical components of modern wastewater management systems, ensuring that sewage is efficiently transferred from lower to higher elevations when gravity flow is not feasible. Whether you need a lift station installed, repaired, or replaced in the **Tampa, Florida** area, you can contact our team at Southern Water and Soil for assistance. ![Lift Stations in Tampa, Florida](/wp-content/uploads/2023/04/kYZK-CJQ-res.jpeg) Installing a lift station is a complicated task that requires careful planning and execution. Our team has more than 30 years of combined experience working on septic systems, including **lift stations**. Before installation, we’ll conduct a thorough assessment of your site, paying attention to details such as wastewater volume, elevation variances, and any other requirements you may have. From there, we’ll make sure your lift station is correctly designed and installed, giving you peace of mind. However, even with precise installation, there may be times when **lift stations** require repairs or even replacement. Once again, our team can assist, offering prompt and effective services to help avoid inconveniences and potential health risks. If we assess the lift station and realize a replacement is needed rather than repair services, we’ll review this with you, providing all viable options so you can make an informed choice. The septic team you choose is more important than you think. Pay attention to their experience, communication, and follow-through. For our team, we’re committed to ensuring our customers not only get the services they need but also gain knowledge about their system and its various parts. If you need assistance with lift stations or another component of your septic system, [contact](/contact-southern-water-and-soil/) a member of our team today. --- *At Southern Water and Soil, we install and service **lift stations** in [Brooksville](/residential-septic-brooksville-fl/lift-stations/), [Dade City](/residential-septic-dade-city-fl/lift-stations/), [Fort Myers](/residential-septic-fort-myers-fl/lift-stations/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and **[Tampa](/residential-septic-tampa-fl/lift-stations/)**, Florida.* ### Similar Services We Offer: --- ### [Lift Stations, Fort Myers, FL](https://southernsepticanddesign.com/residential-septic-fort-myers-fl/lift-stations/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## Contact us if you notice that your lift station isn’t working properly. Your septic system is an important part of dealing with home wastewater, and **lift stations** are an important part of making sure that wastewater moves efficiently from lower levels to higher ones. Lift stations that aren’t working properly can cause big problems in your septic system. If you can spot the signs of trouble early on, you can avoid expensive fixes and possible health risks. Once you spot the signs below, you can contact our team at Southern Water and Soil to remedy the situation. ![Lift Stations in Fort Myers, Florida](/wp-content/uploads/2023/04/kYZK-CJQ-res.jpeg) One of the most obvious signs that something is wrong with lift stations is a strong odor. If you consistently smell sewage, it could mean that something is wrong with the lift station, allowing sewage to build up and release unpleasant gases. In addition, if you notice your drains moving slower than normal, it could mean that the lift station is having trouble pumping wastewater properly. At the same time, this could also be due to a clog or a malfunctioning pump. However, both problems would require prompt repair services from our team. Beyond a strong odor and slow-moving drains, **lift stations** in need of repair might also cause strange gurgling or bubbling sounds coming from your toilets and sinks. This could happen when air is stuck, there’s a blockage, or a check valve isn’t working properly. These are only a few of the signs that indicate your lift station may need professional repair services. If you’re concerned about your septic system in the **Fort Myers, Florida** area, [contact our team](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we install and service **lift stations** in [Brooksville](/residential-septic-brooksville-fl/lift-stations/), [Dade City](/residential-septic-dade-city-fl/lift-stations/), [**Fort Myers**](/residential-septic-fort-myers-fl/lift-stations/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/residential-septic-tampa-fl/lift-stations/), Florida.* --- ### [Lift Stations, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/lift-stations/) **Published:** November 2, 2023 **Author:** Southern Water Soil **Content:** ## Our skilled team can install new lift stations and repair existing units. Many properties located throughout **Brooksville, Florida** area rely on septic systems to store and process liquid and solid waste. Some of these systems rely on gravity to move waste, but not all properties are able to accommodate this type of setup. In these situations, **lift stations** are often used to ensure that liquids and solids can move through the systems properly. A lift station relies on a pump to function properly, and these pumps need to be well-maintained to avoid costly and unpleasant disasters. ![Lift Stations in Brooksville, Florida](/wp-content/uploads/2023/04/kYZK-CJQ-res.jpeg) At Southern Water and Soil, we’re experts in all things related to septic systems and their components. In fact, we’re one of the top-rated providers of septic services, offering design, installation, repair, and maintenance services to local property owners. If you’re looking to add a new or replacement system to your property, our technicians can assess the situation and come up with a customized plan. When necessary, we can incorporate lift stations into our plans to make sure that everything continues to flow properly. In addition to installing lift stations, we’re available to work on existing units. When your system includes this vital component, you may notice that it’s not performing as it should. Over time, **lift stations** may start to wear out or suffer damage, requiring immediate attention. Our technicians can assess any concerns with the component and come up with a plan to repair or replace it. Don’t hesitate to [reach out to us](/contact-southern-water-and-soil/) at the first sign of a septic concern, whether it relates to the lift station or any other part of your vital waste storage system. --- *At Southern Water and Soil, we install and service **lift stations** in [**Brooksville**](/residential-septic-brooksville-fl/lift-stations/), [Dade City](/residential-septic-dade-city-fl/lift-stations/), [Fort Myers](/residential-septic-fort-myers-fl/lift-stations/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/residential-septic-tampa-fl/lift-stations/), Florida.* --- ### [Lift Stations, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/lift-stations/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## Our team specializes in lift stations and other elements of septic systems. Many properties located in and around **Dade City, Florida** rely on septic systems to process and store waste. But depending on the layout of the property and design of the system, a lift station may be necessary. ![Lift Stations in Dade City, Florida](/wp-content/uploads/2023/04/kYZK-CJQ-res.jpeg) **Lift stations** are designed to pump waste through systems when gravity can’t achieve that goal. Not all septic systems include lift stations, but they’re essential components on many commercial and residential properties. Our team at Southern Water and Soil specializes in lift stations and other elements of septic systems. We have a team of technicians who can design and install systems, with or without lift stations. Additionally, we can repair and replace existing components to ensure that liquid and solid waste move through the system with ease. If you currently have a lift station as part of your septic system, it’s important to keep an eye on its functionality. You might notice that drains are moving more slowly or water is backing up on the property. These warning signs can indicate a problem that requires immediate attention. You could have a lift station that is no longer functional or a blockage elsewhere in the system. We’ll send a technician right away to figure out what’s going on and how to solve the problem. When working on **lift stations** and other septic components, we apply our extensive knowledge in the industry. If you have questions about our services, [give us a call](/contact-southern-water-and-soil/). We’re happy to provide answers and additional information about how we can help keep your system working correctly. --- *At Southern Water and Soil, we install and service **lift stations** in [Brooksville](/residential-septic-brooksville-fl/lift-stations/), [**Dade City**](/residential-septic-dade-city-fl/lift-stations/), [Fort Myers](/residential-septic-fort-myers-fl/lift-stations/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/residential-septic-tampa-fl/lift-stations/), Florida.* ### Similar Services We Offer: --- ### [Drain Field Replacement, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/drain-fields/drain-field-replacement/) **Published:** August 1, 2024 **Author:** Southern Water Soil **Content:** ## You can rely on our team to deliver quality septic services, including drain field replacement. There are times when drain field replacement is required to keep your system functioning as it should in the **Tampa, Florida** area. The drain field is where effluent from your septic tank is filtered and disseminated into the soil. However, drain fields can fail over time for a variety of reasons, including clogged pipes, tree root intrusion, or just old age. When this occurs, it is critical to contact our team at Southern Water and Soil as soon as possible to help avoid environmental contamination and health risks. ![Drain Field Replacement in Tampa, Florida](/wp-content/uploads/2024/08/Real-Estate-Sale-Septic-Inspections.webp) Our team brings more than 30 years of combined experience to the table, which means we fully understand the complexities of septic systems. This understanding allows us to accurately evaluate problems and propose the most effective solutions, ensuring your system will be up and running in no time. When you contact us about **drain field replacement**, we’ll take the time to answer any questions you have before assessing your existing system. During this inspection, we take factors like soil composition, groundwater levels, and the layout of your land into consideration to ensure we take steps to avoid future issues and ensure the longevity of the new drain field. While **drain field replacement** might seem like a simple matter, the truth is that the quality of craftsmanship has a direct impact on the performance and longevity of your new drain field. We strive to provide you with the highest levels of quality, ensuring that every step of the replacement procedure is carried out with accuracy, from digging the trenches to placing the pipes and covering the field. This attention to detail reduces the likelihood of future troubles while increasing the efficiency of your septic system. If you need drain field replacement in the Tampa area, [contact](/contact-southern-water-and-soil/) our team today. --- *At Southern Water and Soil, we offer **drain field replacement** services in [Brooksville](/residential-septic-brooksville-fl/drain-fields/drain-field-replacement/), [Dade City](/residential-septic-dade-city-fl/drain-fields/drain-field-replacement/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/drain-fields/drain-field-replacement/), and **[Tampa](/residential-septic-tampa-fl/drain-fields/drain-field-replacement/)**, Florida.* --- ### [Drain Field Replacement, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/drain-fields/drain-field-replacement/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## You can count on our team to provide the expert drain field replacement services you need. The drain field is the part of a septic system responsible for filtering and treating wastewater before letting it seep back into the soil. It consists of a network of pipes and filters connected to your septic tank. Over time, your drain field will likely develop issues such as clogs or other minor problems, which can usually be repaired. Eventually, however, the drain field may accumulate so much wear and tear that it needs to be replaced altogether. Our team at Southern Water and Soil has over 30 years of experience in the septic industry, and we can determine whether you need a **drain field replacement**. If your drain field does need to be replaced, we can also take care of the replacement process for you. ![Drain Field Replacement in Spring Hill, Florida](/wp-content/uploads/2017/09/Real-Estate-Sale-Septic-Inspections.jpg) The biggest factor we consider when discussing drain field replacement is how frequently you are experiencing drain field issues. If your drain field has only needed to be repaired once in the past five or ten years, then it probably has more life in it. However, if you’ve needed multiple drain field repairs within the past 12 months, then we will most likely recommend a complete replacement. Either way, we’ll do everything necessary to restore your system to optimal working condition. We are proud to serve the **Spring Hill, Florida** area, and we want to help you keep your septic system in great condition. If you suspect it’s time for a **drain field replacement**, we encourage you to [give us a call](/contact-southern-water-and-soil/) to get our experts on the job. --- *At Southern Water and Soil, we offer **drain field replacement** services in [Brooksville](/residential-septic-brooksville-fl/drain-fields/drain-field-replacement/), [Dade City](/residential-septic-dade-city-fl/drain-fields/drain-field-replacement/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, **[Spring Hill](/residential-septic-spring-hill-fl/drain-fields/drain-field-replacement/)**, and [Tampa](/residential-septic-tampa-fl/drain-fields/drain-field-replacement/), Florida.* --- ### [Drain Field Replacement, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/drain-fields/drain-field-replacement/) **Published:** January 15, 2024 **Author:** Southern Water Soil **Content:** ## Reach out to us when you need drain field replacement or have any other septic needs. The drain field in your septic system plays a crucial role in managing treated liquid waste and allowing it to move back into the soil. However, a problem with this component can threaten the safety and condition of your property, making it one of the most vital in the entire system. While the parts that make up this piece of your septic system are designed to last for years with proper maintenance, they may wear out or suffer damage. When this happens, it’s important to take immediate action by contacting our team at Southern Water and Soil. ![Drain Field Replacement in Brooksville, Florida](/wp-content/uploads/2017/09/Real-Estate-Sale-Septic-Inspections.jpg) We’ll start with a thorough inspection of the drain field and other septic components and discuss our findings with you. From there, we can provide information about a **drain field replacement** if we believe that is the best course of action. A drain field replacement is necessary when the components that allow it to function properly have sustained significant damage or are beyond repair. Some of the warning signs that your drain field is not functioning as it should include unpleasant odors on the property, pools of water on the ground, and places where the grass looks brighter in color than others. When performing drain field replacement, we assess the entire outdoor space to determine the best location for placement. Our goal is to protect the drain field and other septic components, so we’ll make sure it’s installed in an area where it won’t be driven over or have heavy loads on top of it regularly. [Reach out to us](/contact-southern-water-and-soil/) to learn more about **drain field replacement** or how we can assist with any other septic needs in the **Brooksville, Florida** area. --- *At Southern Water and Soil, we offer **drain field replacement** services in [**Brooksville**](/residential-septic-brooksville-fl/drain-fields/drain-field-replacement/), [Dade City](/residential-septic-dade-city-fl/drain-fields/drain-field-replacement/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/drain-fields/drain-field-replacement/), and [Tampa](/residential-septic-tampa-fl/drain-fields/drain-field-replacement/), Florida.* --- ### [Drain Field Replacement, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/drain-fields/drain-field-replacement/) **Published:** May 9, 2023 **Author:** Southern Water Soil **Content:** ## We can effectively replace your aging drain field. Your drain field is responsible for treating wastewater before it’s discharged into the surrounding soil. Over time, your drain field can become damaged or clogged, leading to a variety of issues with your septic system. Although many of these issues can be fixed, there may come a day where you need to consider **drain field replacement**. ![Drain Field Replacement in Dade City, FL](/wp-content/uploads/2017/09/Real-Estate-Sale-Septic-Inspections.jpg) Some common issues with your drain field could include sewage backups, slow drains, soggy or wet areas around your septic system, and foul odors that come from the area around your septic system. Needing drain field repair every once in a while is nothing to worry about, but if you experience issues on a frequent basis, your drain field could be failing. At Southern Water and Soil, we are your source for efficient, effective, and professional **drain field replacement** services. We serve the **Dade City, Florida** area and are here to ensure your drain field properly supports the operations of your septic system. If you suspect that you need a new drain field, we will come to your property and inspect what’s going on. If we think we can implement a long-term fix, we will let you know. But if we determine that your drain field is nearing the end of its lifespan, we can move ahead with the replacement process. We’ll replace your drain field in no time and ensure it will provide years of worry-free operation. [Contact us today](/contact-southern-water-and-soil/) to learn more about our drain field replacement services and to set up an inspection of your drain field. --- *At Southern Water and Soil, we offer **drain field replacement** services in [Brooksville](/residential-septic-brooksville-fl/drain-fields/drain-field-replacement/), [**Dade City**](https://southernsepticanddesign.com/residential-septic-dade-city-fl/drain-fields/drain-field-replacement/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/residential-septic-spring-hill-fl/drain-fields/drain-field-replacement/), and [Tampa](/residential-septic-tampa-fl/drain-fields/drain-field-replacement/), Florida.* --- ### [Drain Field Repair, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/drain-fields/drain-field-repair/) **Published:** August 1, 2024 **Author:** Southern Water Soil **Content:** ## Our team offers quality drain field repair services in the Tampa area. A properly operating septic system is critical for handling wastewater in many homes and businesses, especially in areas where you’re not able to connect to a municipal sewer system. The drain field is a critical component of this system since it handles the final stage of wastewater treatment. When a drain field fails, it can cause serious issues, such as groundwater contamination, unpleasant odors, and expensive repairs. This is where our team at Southern Water and Soil comes in, offering quality **drain field repair** when you need it most. ![Drain Field Repair in Tampa, Florida](/wp-content/uploads/2024/08/iStock-503714218_res.jpg) The drain field, which consists of a network of perforated pipes buried in gravel-filled trenches, filters and disperses treated wastewater from the septic tank. As wastewater passes through these pipelines, the surrounding soil purifies it before it returns to the groundwater system. Unfortunately, as mentioned, there may be times when **drain field repair** is needed to ensure the system continues to function as it should. Our team has the skills and more than 30 years of combined experience to effectively identify the root cause of drain field issues. We also have the necessary tools to conduct thorough inspections and discover problems that the untrained eye may miss. This attention to detail helps guarantee that we’ll take the appropriate steps regarding drain field repair to ensure the issues are fixed. We can also provide valuable advice on how to maintain your system and possibly prevent future problems. In addition, we’ll take the time to answer any questions you have to ensure you fully understand our process. For us, it’s important that you understand how your septic system works so you’re able to spot signs that something might be wrong and feel confident in asking for our assistance. If you think you need drain field repair in the **Tampa, Florida** area or you’re curious about your system’s condition, [reach out](/contact-southern-water-and-soil/) to a member of our team today. --- *At Southern Water and Soil, we offer **drain field repair** services in [Brooksville](/residential-septic-brooksville-fl/drain-fields/drain-field-repair/), [Dade City](/residential-septic-dade-city-fl/drain-fields/drain-field-repair/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and **[Tampa](/residential-septic-tampa-fl/drain-fields/drain-field-repair/)**, Florida.* --- ### [Drain Field Repair, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/drain-fields/drain-field-repair/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## Hire us to fix your drain field. Your septic system’s drain field is one of the most important parts of the entire system. Your drain field is where wastewater ends up after it leaves the septic tank, and it gets absorbed and treated at this point. If something goes wrong with your drain field, you could end up with issues with other parts of your septic system, and your system as a whole could stop functioning. ![Drain Field Repair in Brooksville, Florida](/wp-content/uploads/2018/02/iStock-503714218_resized.jpg) At Southern Water and Soil, we perform **drain field repair** work throughout the **Brooksville, Florida** area. If you suspect that something is wrong with your drain field, contact us. We will send out one of our professionals to diagnose the issue and come up with a plan for fixing it. When we set up an appointment for drain field repair, we will arrive on time and provide excellent workmanship. We will make sure that your drain field is fully repaired before we leave your property, ensuring that your septic system is completely functional. We suggest calling us for drain field repair right away if your toilets, sinks, and showers have started running slower than usual or if the area around your septic tank has become soggy and wet. You may also need drain field repair if you are experiencing sewage backups. Our team is thorough, professional, and has years of experience diagnosing and fixing drain field issues. The next time you need **drain field repair** services, [contact us](/contact-southern-water-and-soil/) right away. --- *At Southern Water and Soil, we offer **drain field repair** services in [**Brooksville**](/residential-septic-brooksville-fl/drain-fields/drain-field-repair/), [Dade City](/residential-septic-dade-city-fl/drain-fields/drain-field-repair/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/residential-septic-tampa-fl/drain-fields/drain-field-repair/), Florida.* --- ### [Drain Field Repair, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/drain-fields/drain-field-repair/) **Published:** May 9, 2023 **Author:** Southern Water Soil **Content:** ## We can fix your drain field to ensure its operation. Your drain field is a critical element of your property’s septic system. When wastewater finally leaves your home, it settles here, where it is naturally treated and absorbed by the surrounding landscaping. If your drain field isn’t working correctly, it can lead to a variety of issues, including sewage backups, contaminated groundwater, and foul odors emanating from your system. ![Drain Field Repair in Dade City, FL](https://b593516.assetcdn.net/593516/wp-content/uploads/2018/02/iStock-503714218_resized.jpg?lossy=1&strip=0&webp=1) If you suspect that you need **drain field repair**, turn to us at Southern Water and Soil. We are septic professionals in the **Dade City, Florida** area with years of experience diagnosing and fixing drain field issues. Some of the signs you should call us to provide drain field repair services include the following: - Your sinks, showers, and toilets have started draining slower than usual due to a buildup of solids in your drain field. - You’ve noticed that the area around your septic system has become soggy and wet, which could mean your drain field isn’t absorbing wastewater properly. - Unpleasant smells have started to emanate from the area around your septic system because wastewater is not being treated correctly. - Your drain field is preventing wastewater from properly flowing out of your septic tank, causing frequent sewage backups. Choose us for your **drain field repair** and we’ll effectively assess the situation and determine the best way to get your drain field working properly again. For more information about our drain field repair services or to schedule an appointment, [get in touch](/contact-southern-water-and-soil/) with us today. ### FAQs About Drain Field Repair If you have a septic system, you also have a drain field as part of that system. You know that for the system to work to its potential, all the parts need to be in good working order. We often get called out for drain field repair, which leads our client to ask what they can do to maintain this vital part and how the process of repair works. The answers to these and other questions we’re often asked are below. ##### Hidden ##### Is there anything I can do to help my drain field function better? Over time, your [drain field](/residential-septic-services-dade-city-fl/drain-fields/) will need repairs due to normal wear and tear, but you can help it last longer by ensuring it is inspected regularly, avoiding excessive water usage, and ensuring that non-biodegradable items aren’t flushed into the system. ##### How can I tell whether repairs are necessary for my drain field? Slow drainage, foul smells, damp soil or standing water around the drain field area, and sewage backups in the plumbing system are typical indicators of problems with the drain field. Our team can perform an assessment to examine the condition of the drain field and what repairs might be needed. ##### What are the typical techniques for fixing drain fields? Aerating the soil, changing broken pipes, adding a bacterial additive to increase microbial activity, and occasionally relocating the drain field are common restoration techniques. Once we assess your drain field needs, we can create a detailed repair plan. ##### How long do drain fields last? Numerous elements, such as appropriate upkeep, soil conditions, and usage, affect how long a drain field lasts. A well-kept drain field can endure for at least 20 to 30 years on average. *At Southern Water and Soil, we offer **drain field repair** services in [Brooksville](/residential-septic-brooksville-fl/drain-fields/drain-field-repair/), **[Dade City](/residential-septic-dade-city-fl/drain-fields/drain-field-repair/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/residential-septic-tampa-fl/drain-fields/drain-field-repair/), Florida.* --- ### [Drain Fields, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/drain-fields/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## Damaged drain fields can completely disrupt your home’s septic system. Your **Tampa, Florida** home’s septic system involves more than a tank sitting underneath the ground. Underground and downstream from the tank is a drain field that collects the liquid waste from the tank as it prepares for treatment and discharge into the ground. As you can probably assume, **drain fields** are very important to the overall functionality of the septic systems they’re included in, and drain field damages can be highly destructive, both for the environment and your septic system. ![Drain Fields in Tampa, Florida](/wp-content/uploads/2023/04/a0MyXQG0-res.jpeg) Identifying and handling problems related to drain fields is one of our many specialties here at Southern Water and Soil. We are well-versed in all of the problems that your drain field can face as well as how to fix them properly. Like with all of our other services, our drain field repair and replacement services are second to none and done right the first time, so you won’t have to worry about subpar results. It’s important to hire professional services for your drain field as soon as you suspect any problems to help avoid large-scale disasters or lasting damages that can be avoided. Damages to **drain fields** are never problems that you should try to fix on your own, so be sure to reach out to our team whenever your drain field is acting up. We’ll be happy to answer any questions you may have about what is causing your drain field to act up and what you can do in the future to help protect it from issues, so [give us a call](/contact-southern-water-and-soil/) today for all of your drain field-related needs. --- *At Southern Water and Soil, we install and service **drain fields** in [Brooksville](/residential-septic-brooksville-fl/drain-fields/), [Dade City](/residential-septic-dade-city-fl/drain-fields/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/drain-fields/), and [**Tampa**](/residential-septic-tampa-fl/drain-fields/), Florida.* ### Similar Services We Offer: --- ### [Drain Fields, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/drain-fields/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## You can count on our team to keep your drain fields in excellent condition. Every septic system contains two main components: the tank and the drain field. Some systems have additional components, such as a grease trap, but every system has those two. The septic tank is the first stop wastewater makes after it flows down your drain. In the tank, solid waste sinks to the bottom, where bacteria break it down. ![Drain Fields in Spring Hill, Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/04/a0MyXQG0-res.jpeg?lossy=1&strip=0&webp=1) Liquid effluent, on the other hand, makes a second stop. It flows out of the tank and into the drain field, a network of pipes and filters. These filters treat the wastewater and let it gradually seep back into the ground. Our team at Southern Water and Soil has over 30 years of experience in the septic industry, and we have worked on countless **drain fields** over the years. If you are having a problem with your drain field or need someone to build one for a new system, you can turn to us for help. In our time in the septic industry, we have designed and built drain fields for a wide range of clients, including people in many different industries as well as private homeowners. Our team has also encountered just about every problem it’s possible for drain fields to develop, so we can provide effective repairs for any issue your drain field may have. Our team is proud to serve the **Spring Hill, Florida** area, and we want to help you keep your septic system in good working order. If you are looking for a company to work on your **drain fields**, just [give us a call](/contact-southern-water-and-soil/) to find out more about what we can do for you. ### FAQs About Drain Fields When it comes to your septic system, there are many parts that work together to ensure its success. The drain field is one of those parts. With over 30 years of combined service in the septic industry, our team at Southern Water and Soil knows a lot about drain fields, and we’ve compiled a list of questions that our customers ask most often. You can see those questions and the answers below. ##### Hidden ##### How does a drain field work? The drain field in a [septic system](/nitrogen-reducing-septic-system-dade-city-fl/nsf-245-septic-systems/) enables the distribution and absorption of the treated wastewater from the septic tank into the soil. Before the water reaches the groundwater system again, the earth serves as a natural filter, eliminating contaminants and dangerous germs. ##### How do I know if my drain field is failing? There are a few signs to look for if you’re concerned about your drain field, such as slow-draining fixtures, foul smells, thick vegetation covering the drain field, pooling water, and gurgling sounds in the plumbing. It’s critical to take quick action to treat the issue if you observe these symptoms to prevent more serious issues. ##### How frequently should a drain field be inspected? The optimal frequency of a professional examination is every three to five years, while the actual frequency may differ depending on the size of the household, water use, and kind of septic system. ##### Is it okay for me to put buildings or trees over my drain field? In general, it’s best to stay away from covering the drain field with permanent structures or trees. Tree roots can cause damage to pipes, and buildings can flatten the soil, which prevents wastewater from being absorbed. ##### How can I keep my drain field in good condition? Only flushing biodegradable things and avoiding excessive water use are part of proper maintenance. To keep particles from getting into the drain field, regular septic tank inspections are also essential. *At Southern Water and Soil, we install and service **drain fields** in [Brooksville](/residential-septic-brooksville-fl/drain-fields/), [Dade City](/residential-septic-dade-city-fl/drain-fields/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, **[Spring Hill](/residential-septic-spring-hill-fl/drain-fields/)**, and [Tampa](/residential-septic-tampa-fl/drain-fields/), Florida.* ### Similar Services We Offer: --- ### [Drain Fields, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/drain-fields/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## Drain fields are an important and often overlooked key component of septic systems. When you think of your septic system, which probably isn’t often if it is working well, you most likely think of your septic tank. This tank is generally constructed out of concrete and buried underground near your residential or commercial building. The tank is important, as it is where solid waste settles out of the liquid waste. Septic tanks need periodic maintenance, usually in the form of pump-outs that remove this accumulated sludge, leaving room for the system to operate properly. ![Drain Fields in Brooksville, Florida](/wp-content/uploads/2023/04/a0MyXQG0-res.jpeg) But where does the liquid go? That’s where **drain fields** come in. Drains fields are an important and often overlooked key component of septic systems. The placement and design of drain fields are key to the overall success of the septic system. The drain field is tasked with protecting the surrounding environment from potentially hazardous bacteria and pathogens in the wastewater. Generally, drain fields consist of a set of perforated pipes that are buried carefully and thoughtfully. There is usually a layer of gravel or another filter material as well. At Southern Water and Soil, we have over 30 years of experience with drain fields and all the other components of septic systems. We can inspect existing systems and make recommendations about how to repair or upgrade them. We can also design and install new septic systems in **Brooksville, Florida** or the surrounding area. We also offer repair and maintenance services, allowing you to ensure that your septic system is performing properly and that its expected lifespan can be maximized. [Contact us](/contact-southern-water-and-soil/) now for help with your **drain fields**, or any other septic-related needs or questions. --- *At Southern Water and Soil, we install and service **drain fields** in [**Brooksville**](/residential-septic-brooksville-fl/drain-fields/), [Dade City](/residential-septic-dade-city-fl/drain-fields/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/drain-fields/), and [Tampa](/residential-septic-tampa-fl/drain-fields/), Florida.* ### Similar Services We Offer: --- ### [Drain Fields, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/drain-fields/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## When working on drain fields, we ensure the best placement and design. There are a number of components at work within a septic system, which is a self-contained tool for storing and processing waste. When you rinse liquid down a drain or flush a toilet in your **Dade City, Florida** home, the wastewater and solids move through the plumbing system to a tank, which is buried beneath the ground. The septic tank stores the solid waste and allows treated liquid to move out to the drain field. In septic systems, **drain fields** are among the most vital components in protecting the environment from contamination. A drain field typically includes a set of perforated pipes, which are buried underground with a layer of gravel or another filtering material surrounding the pipes. ![Drain Fields in Dade City, Florida](/wp-content/uploads/2023/04/a0MyXQG0-res.jpeg) Protecting the drain field is a must if you want to keep your system working properly. Regular inspections are an essential aspect of septic system ownership, and our team at Southern Water and Soil can take care of this on your property. We serve those located throughout the area, offering drain field installation, repair, and maintenance to both residential and commercial clients. When working on drain fields, we ensure the best placement and design. Our technicians can place new **drain fields** and repair or replace existing ones to keep things flowing smoothly within your septic system. With years of experience, we take pride in the work we do for local property owners. We’re a trusted provider of septic services, so you can depend on us for professional drain field services. [Contact us](/contact-southern-water-and-soil/) to request an estimate or learn more about the services we provide. --- *At Southern Water and Soil, we install and service **drain fields** in [Brooksville](/residential-septic-brooksville-fl/drain-fields/), [**Dade City**](/residential-septic-dade-city-fl/drain-fields/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/drain-fields/), and [Tampa](/residential-septic-tampa-fl/drain-fields/), Florida.* ### Similar Services We Offer: --- ### [Residential Septic, Tampa, FL](https://southernsepticanddesign.com/residential-septic-tampa-fl/) **Published:** May 6, 2024 **Author:** Southern Water Soil **Content:** ## Our team is qualified to handle all of your residential septic system needs. Quality septic systems are designed to last, which is why many homeowners prefer relying on septic systems over traditional city sewer systems. However, maintaining a **residential septic** system isn’t as simple as installing a tank and forgetting about it. You’ll need professional septic system services to address any residential septic needs that you may have. ![Residential Septic in Tampa, Florida](/wp-content/uploads/2023/03/septicsystemwarrantypackagesres.jpg) Here at Southern Water and Soil, we are your one-stop shop for all things septic-related, including designing, installing, and maintaining your residential septic system. The proper treatment and disposal of your home’s waste is crucial for maintaining your property’s well-being as well as sanitary health. Issues like leaks or damages to your tank can lead to sickness and property damage, so it’s best to turn to us any time you encounter problems with your septic system. Whether you’re looking to design and install a septic system for the first time or you have an existing system that needs repair or maintenance services, we’ve got you covered. Our comprehensive services here in the **Tampa, Florida** area are designed to help you protect your property while safely and effectively managing the waste that your property accumulates. For years, we’ve been helping our clients with their residential septic needs and are happy to help design and maintain systems that meet your requirements. We specialize in septic engineering to outfit a property with a system that fits its needs and specifications, and we do this process right the first time. For **residential septic** systems, we oversee permitting, design, engineering, and any considerations for potential BMAP planning for installations and replacements, and the physical installation work is handled by one of our carefully vetted partners. For all of your residential septic needs, don’t hesitate to [contact our team](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we offer **residential septic services** in [Brooksville](/residential-septic-brooksville-fl/), [Dade City](/residential-septic-dade-city-fl/), [Fort Myers](/residential-septic-fort-myers-fl/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/), [Odessa](/residential-septic-odessa-fl/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/), and [**Tampa**](/residential-septic-tampa-fl/), [Florida](/residential-septic-florida/).* ### Similar Services We Offer: --- ### [Residential Septic, Spring Hill, FL](https://southernsepticanddesign.com/residential-septic-spring-hill-fl/) **Published:** September 8, 2023 **Author:** Southern Water Soil **Content:** ## Make us your trusted source for residential septic services. Your home’s septic system is comprised of a series of components that need to work with each other to keep waste flowing from your toilets, showers, and sinks all the way out to your drain field for final treatment. If something goes wrong with your pipes, septic tank, or drain field, you could end up with a septic problem that requires the help of a professional. ![Residential Septic in Spring Hill, Florida](/wp-content/uploads/2019/09/2012-11-21-10.30.10-res.jpg) At Southern Water and Soil, we have years and years of experience working on **residential septic** projects. From full-scale design and engineering to minor repairs, we do it all. Call us if you need help fixing your septic system, installing a new system, replacing an old one, or even if you just have questions about maintenance. Our septic professionals are always happy to provide helpful information and guidance on all things septic. Not only are we a wealth of information on all things residential septic, but we also work hard to provide excellent service. There’s a reason so many homeowners in the **Spring Hill, Florida** area trust us with all their septic needs, and it comes down to the way we handle each and every septic project and the level of customer service we provide. When you need a **residential septic** professional you can count on to go above and beyond during your project, we’re the ones to call. [Contact us](/contact-southern-water-and-soil/) directly to tell us more about your project or book an appointment for septic service. --- *At Southern Water and Soil, we offer **residential septic services** in [Brooksville](/residential-septic-brooksville-fl/), [Dade City](/residential-septic-dade-city-fl/), [Fort Myers](/residential-septic-fort-myers-fl/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/), [Odessa](/residential-septic-odessa-fl/), Orlando, Plant City, **[Spring Hill](/residential-septic-spring-hill-fl/)**, and [Tampa](/residential-septic-tampa-fl/), [Florida](/residential-septic-florida/).* ### Similar Services We Offer: --- ### [Residential Septic, Odessa, FL](https://southernsepticanddesign.com/residential-septic-odessa-fl/) **Published:** September 8, 2023 **Author:** Southern Water Soil **Content:** ## We’re your residential septic experts. In **Odessa, Florida**, many homes rely on septic systems to process wastewater. Just like those with properties that are hooked up to the municipal sewer system, you’re responsible for caring for your wastewater system and making sure everything is working smoothly. ![Residential Septic in Odessa, Florida](/wp-content/uploads/2019/09/2012-11-21-10.30.10-res.jpg) Although most septic systems are relatively low maintenance, there may come a day when you need a **residential septic** company to step in and help. At Southern Water and Soil, we are that company. We’re one of the most experienced septic companies in the area, and we know what we’re doing when it comes to anything septic. We also provide all the residential septic services you could ever need to properly maintain your system. Some of these include: - **Septic repairs—**The next time something goes wrong with your septic system, don’t panic. Call our residential septic professionals to come and take care of the issue quickly and effectively. - **Septic installs—**We can install septic systems of all types and complexities. Just let us know your requirements, and we’ll take care of the rest. - **Septic design and engineering—**Every property is unique, so quality septic design is a must. Trust us to design and engineer a septic system for your home that works like it should. - **Septic replacements—**If the day has arrived when you need to replace your septic system, hire us to handle the project from beginning to end. As **residential septic** professionals, our goal is to exceed your expectations. To learn more about our septic services, [reach out to us today](/contact-southern-water-and-soil/)! --- *At Southern Water and Soil, we offer **residential septic services** in Brooksville, [Dade City](/residential-septic-dade-city-fl/), [Fort Myers](/residential-septic-fort-myers-fl/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/), **[Odessa](/residential-septic-odessa-fl/)**, Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/), and [Tampa](/residential-septic-tampa-fl/), [Florida](/residential-septic-florida/).* ### Similar Services We Offer: --- ### [Residential Septic, Miami, FL](https://southernsepticanddesign.com/residential-septic-miami-fl/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## We can help you with your residential septic system. If your home in **Miami, Florida** uses a septic system, you are not alone. Many households in this part of the country rely on a septic system for wastewater management and disposal. When wastewater leaves your home, it travels to your septic system, where the effluent leaves the tank and solid waste settles at the bottom. This effluent travels out to the drain field, where it is treated naturally and then returned to the surrounding soil. ![Residential Septic in Miami, Florida](/wp-content/uploads/2020/08/2012-11-21-10.30-res.jpg) If your home uses a septic system, you need a septic contractor who can help you take care of this system properly and reliably. We believe that our team here at Southern Water and Soil can become your reliable contractor thanks to our many years of experience in the septic industry. We provide a variety of **residential septic** services that can help you take proper care of your septic system and prevent major problems. Some of the residential septic services we offer include septic repairs, septic installations, septic design, and septic maintenance. Whether you need someone to come and inspect your septic system, design a new system for your property, or repair your system when something goes wrong, our team of professionals is always just a phone call away. Our goal is to exceed your expectations with the quality of our **residential septic** services. To learn more about these septic services or to schedule your next service appointment, get in touch with one of our friendly team members today. --- *At Southern Water and Soil, we offer **residential septic services** in [Brooksville](/residential-septic-brooksville-fl/), [Dade City](/residential-septic-dade-city-fl/), [Fort Myers](/residential-septic-fort-myers-fl/), Land O’ Lakes, Lutz, **[Miami](/residential-septic-miami-fl/)**, [Odessa](/residential-septic-odessa-fl/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/), and [Tampa](/residential-septic-tampa-fl/), [Florida](/residential-septic-florida/).* ### Similar Services We Offer: --- ### [Residential Septic, Fort Myers, FL](https://southernsepticanddesign.com/residential-septic-fort-myers-fl/) **Published:** May 28, 2023 **Author:** Southern Water Soil **Content:** ## We’ll design the most effective and reliable septic system for your home. Navigating the complexities of **residential septic** systems might seem daunting, but at Southern Water and Soil, we’ve made it our mission to simplify this essential aspect of homeownership in **Fort Myers, Florida**. We bring over three decades of expertise to the table, offering comprehensive septic solutions that blend innovation, efficiency, and affordability. ![Residential Septic in Fort Myers, Florida](/wp-content/uploads/2023/05/2012-11-21-10.30.10-res.jpg) A **residential septic** system plays a vital role in any home not connected to the public sewer network. It efficiently treats and disposes of wastewater on site, creating a self-contained, sustainable system. However, its effectiveness and longevity are largely dependent on careful and knowledgeable design, professional installation, and consistent maintenance. We understand every home has unique needs, and we customize our approach accordingly. We provide meticulous site evaluations, considering local soil conditions, property size, and household needs to design the most effective and reliable septic system for your home. Our commitment extends far beyond the initial design and installation. We also offer ongoing maintenance services, prompt repairs, and crucial homeowner education about septic system care and best practices. We want to ensure that your residential septic system remains efficient and free of trouble for the long haul. We understand that transitioning to a septic system or upgrading an existing one can be a weighty decision. Therefore, we prioritize transparency and open communication, providing clear explanations and answering any questions you might have. Trust us for all your residential septic system needs and experience our dedication to quality, service, and customer satisfaction firsthand.[ Contact us](/contact-southern-water-and-soil/) to start planning for your residential septic system today. --- *At Southern Water and Soil, we offer **residential septic services** in [Brooksville](/residential-septic-brooksville-fl/), [Dade City](/residential-septic-dade-city-fl/), **[Fort Myers](/residential-septic-fort-myers-fl/)**, Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/), [Odessa](/residential-septic-odessa-fl/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/), and [Tampa](/residential-septic-tampa-fl/), [Florida](/residential-septic-florida/).* ### Similar Services We Offer: --- ### [Residential Septic, Brooksville, FL](https://southernsepticanddesign.com/residential-septic-brooksville-fl/) **Published:** September 8, 2023 **Author:** Southern Water Soil **Content:** ## Our residential septic experts have years of experience. When you hire a service professional to do any type of work around your home, you want to make sure they have the experience necessary to do the job right. This principle holds true for your septic system – you want to work with a company with plenty of experience in the industry to ensure your wastewater system continues to function like it should. ![Residential Septic in Brooksville, Florida](/wp-content/uploads/2019/09/2012-11-21-10.30.10-res.jpg) At Southern Water and Soil, our team boasts years of experience working on residential septic systems. When you turn to us, your home and your septic system will benefit from this exceptional knowledge and proficiency we have working with **residential septic** systems. We proudly serve the **Brookville, Florida** area, and we’re always eager to exceed expectations with the quality of our customer service and the excellence of our workmanship. Whether you need someone to fix your system, help you plan for a replacement, or design and engineer an entirely new system, you can count on us to use our extensive experience when working on your project. We are happy to answer any and all questions you have about your septic system, and we will always be available during your project to provide further information. We’ll work hard to become the residential septic company you call again and again for help and advice about your home’s septic system. To learn more about our **residential septic** services or book an appointment with us, [give us a call now](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **residential septic services** in **[Brooksville](/residential-septic-brooksville-fl/)**, [Dade City](/residential-septic-dade-city-fl/), [Fort Myers](/residential-septic-fort-myers-fl/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/), [Odessa](/residential-septic-odessa-fl/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/), and [Tampa](/residential-septic-tampa-fl/), [Florida](/residential-septic-florida/).* ### Similar Services We Offer: --- ### [Residential Septic, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/) **Published:** March 24, 2023 **Author:** Southern Water Soil **Content:** ## We provide innovative solutions for residential septic systems. Providing innovative septic solutions for residential septic systems is one of our specialties at Southern Water and Soil. We have partnered with a number of manufacturers to provide the proper solution for every lot or residence we work at in **Dade City, Florida**, and our professionals can expertly design, engineer, and install your residential septic system. ![Residential Septic Services in Dade City, Florida](/wp-content/uploads/2023/03/septicsystemwarrantypackagesres.jpg) Our owner and president – Greg Mayfield – has been in the residential septic business for over 27 years. He has also worked for the Florida Department of Health and spent time reviewing septic designs while employed there. In 2004, Greg founded our septic company and has provided **residential septic services** since the beginning, building an experienced, knowledgeable team to manage any septic need. Our residential septic services include: - Drain field repairs and replacements - Lift station repairs, replacements, and installations - Nitrogen-reducing septic systems - Septic permit applications - Septic pumping services - Septic repairs and maintenance - Septic inspections - Septic engineering We work with carefully vetted partners to provide **residential septic services**, all under the supervision of our experienced leadership team. We also complete work right the first time. And while we’re not your least expensive option, we provide incredible value because a system that is installed and maintained properly from the start will last longer. As Master Septic Contractors, we are also up to date on the most recent guidelines for regions that require new onsite sewage treatment and disposal systems. Whatever your residential septic system needs, whether you want to lower your septic mound, treat for nitrogen, or just have your tank pumped, don’t be afraid to [call us](/contact-southern-water-and-soil/) for exactly what you need. --- *At Southern Water and Soil, we offer **residential septic services** in [Brooksville](/residential-septic-brooksville-fl/), **[Dade City](/residential-septic-dade-city-fl/)**, [Fort Myers](/residential-septic-fort-myers-fl/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/), [Odessa](/residential-septic-odessa-fl/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/), and [Tampa](/residential-septic-tampa-fl/), [Florida](/residential-septic-florida/).* ### Similar Services We Offer: --- ### [Aerobic Septic Systems, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/aerobic-septic-systems/) **Published:** December 22, 2015 **Author:** Southern Water Soil **Content:** ## Our team of experts is ready and waiting to install top-notch aerobic septic systems on residential and commercial Odessa, FL properties. ![Aerobic Septic Systems](/wp-content/uploads/2015/09/2012-11-20-12.45-resize-300x169.jpg)At Southern Water and Soil, we offer a wide variety of septic services, including custom septic tank design and septic system design. Our team includes a variety of industry professionals, such as engineers, licensed contractors, and sanitation specialists. Plus, all of our staff members are cross-trained to ensure that everyone who works on your project is qualified to do so. One of our most popular septic system designs in Odessa, FL is the aerobic septic system. **Aerobic septic systems** are perfect for both residential and commercial applications because they are self-contained and can be designed for either large or small volumes of waste. Most **aerobic septic systems** contain a pretreatment chamber through which the waste and water flow. This chamber contains several types of bacteria that treat the waste, starting the process of separation. The waste then moves into the aeration chamber, where different types of bacteria treat the water, removing all traces of waste. From there, the water flows into the drain field for filtration, disinfection, and chlorination before being released back into the environment. If you are considering having an aerobic septic system installed in Odessa, FL, be sure to make Southern Water and Soil your first call. We have a team of experts standing by to take your call and will be happy to answer your questions and offer you a free quote. Not only will we install your new septic system; we will also remain available for routine maintenance and repairs. --- *At Southern Water and Soil, we install **aerobic septic systems** in [Tampa](/septic-systems-tampa-fl/aerobic-septic-systems), **[Odessa](/commercial-septic-odessa-fl/aerobic-septic-systems/)**, [Lutz](/septic-systems-lutz-fl/aerobic-septic-systems/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/aerobic-septic-systems/), Brandon, Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Aerobic Septic Systems, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/aerobic-septic-systems/) **Published:** June 8, 2016 **Author:** Southern Water Soil **Content:** ## We have seen the benefits of aerobic septic systems for our clients and can assist you in determining if they will work for your residential or commercial property in Land O’ Lakes. ![Aerobic Septic Systems in Land O’ Lakes, Florida](/wp-content/uploads/2014/07/2011-10-25-13.23.32-300x179.jpg)Are you interested in learning more about the benefits of aerobic septic systems? Did you know they are a good option for both residential and commercial properties? Norweco is the primary manufacturer of aerobic septic systems, and their products include everything from small tanks for residences to large, high-volume commercial tanks. **Aerobic septic systems** are also self-contained where much of the necessary processing occurs in a central location. Aerobic septic systems involve several components. - Waste starts in the pipes where it goes into the precast concrete tank. The tank, access covers and riser are strong and durable so material waste is contained safely. - **Aerobic septic systems** also have a pre-treatment chamber where water and waste flow to and from the inlet, which treats wastewater with bacteria and begins the separation process. - Once wastewater has moved to the aeration chamber, other types of bacteria treat the water again to remove remaining traces of waste and allow water to continue on to the drain field. - After going through the aeration chamber, liquids then go through to the Bio-Kinetic system, where water is filtered. - Wastewater is then transported through an optional disinfection and chlorination process. - Once all of the water has been separated from the waste going through the system and it has received all necessary treatment from each component, it goes to the outlet, where it returns to the environment safely. At Southern Water and Soil, we have seen the benefits of these septic systems for our clients and can assist you in determining if they will work for your residential or commercial property. We also have the experience and expertise to assist you with the installation of **aerobic septic systems**. We offer services in Land O’ Lakes, Florida and the surrounding area. [Contact us](/contact-southern-water-and-soil/) today to learn more. --- *At Southern Water and Soil, we install **aerobic septic systems** in [Tampa](/septic-systems-tampa-fl/aerobic-septic-systems), [Odessa](/commercial-septic-odessa-fl/aerobic-septic-systems/), [Lutz](/septic-systems-lutz-fl/aerobic-septic-systems/), **[Land O’ Lakes](/commercial-septic-land-o-lakes-fl/aerobic-septic-systems/)**, Brandon, Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Aerobic Septic Systems, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/aerobic-septic-systems/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Content:** ## Our team has experience with installation and repair of aerobic septic systems in Tampa, FL. ![Aerobic Septic Systems](/wp-content/uploads/2014/07/2011-10-25-13.23.32-300x179.jpg)**Aerobic septic systems** offer a great deal of benefits for both residential and commercial properties. The main manufacturer of these types of systems is Norweco, and their product line includes small residential tanks, as well as large commercial tanks for higher volumes of waste. They are also self-contained processing systems, where most of the action happens in one central location. The waste starts in the pipes, where it goes into the precast concrete tank. This tank, along with the access covers and risers, is strong and durable to ensure that it can hold in the material safely. **Aerobic septic systems** have a pretreatment chamber, where water and waste flow to from the inlet. The chamber contains types of bacteria that treat the waste and begin the separation process. Inside the aeration chamber, other bacteria treat the water to remove any traces of waste and allow the water to continue through to the drain field. After going through the aeration chamber, the liquids then go through to the Bio-Kinetic system, where water is filtered, and then transported through an optional disinfection and chlorination process. After the water has separated from the waste and has received all necessary treatment from each system component, it goes to the outlet, where it returns to the environment safely. At Southern Water & Soil, our team has experience with installation and repair of aerobic septic systems. We offer services in and around Tampa, Florida and can install or fix your septic system on either a residential or commercial property. For more information, [contact us](/contact-southern-water-and-soil/ "aerobic septic systems experts") today! --- *At Southern Water and Soil, we install **aerobic septic systems** in Brooksville, Dade City, Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/aerobic-septic-systems/), Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [**Tampa**](/commercial-septic-tampa-fl/aerobic-septic-systems/), Florida.* --- ### [Drain Field Design, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-drain-field/drain-field-design/) **Published:** September 29, 2015 **Author:** Southern Water Soil **Content:** ## Our team is ready to exceed your expectations when it comes to drain field design in Odessa, FL. **![Drain Field Design](/wp-content/uploads/2015/09/Drain-Field-Design-300x225.jpg)Drain field design** is one of the single most important aspects of a septic system, and one that many people pay little or no attention to. Because the drain field represents the final segment of the septic system, any issues in this process can cause problems throughout your septic system, drain field site, and local water quality. It’s important to take into account the type of soil and drainage rate of that soil. Less-permeable soil requires more time to filter a given amount of water, so a larger drain field might be required, depending on the amount of waste water generated. The amount of waste water generated can also impact **drain field design**, as a larger drain field is necessary to spread that waste water evenly. The location of the drain field is the third important factor in your drain field design, as there are often very specific regulations regarding the placement of the field in relation to structures, pathways, trees, shrubs, water sources, and the local water table. The fourth aspect of drain field design is the biomat. Over continued use, a layer of biomass will form below the drain field in response to the nutrient-rich effluent. This biomatter continues to filter and further purify the effluent, but can slow the flow of effluent, and over time can grow up and into the drain field. If you are installing a new drain field due to an older drain field losing its effectiveness, this older drain field may dry out over time, allowing it to be used again after several years. Incorporating more modern treatment systems or more complex tanks into your septic system can also help your drain field design by yielding a more pure effluent that requires less time and space to fully biodegrade. At Southern Water and Soil, we are proud of our experienced team and ready to exceed your expectations by offering properly designed, cost-effective, and worry-free installation to our customers in Odessa, FL. --- *At Southern Water and Soil, we offer **drain field design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/drain-field-design/), [Dade City](/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-design/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-design/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-design/), Miami, **[Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-design/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-design/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-design/), Florida.* --- ### [Drain Field Options, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-drain-field/drain-field-options/) **Published:** September 29, 2015 **Author:** Southern Water Soil **Content:** ## Our team is well-versed in the many drain field options for our Odessa, FL customers. ![Drain Field Options](/wp-content/uploads/2015/09/Drain-Field-Options-300x225.jpg)There are many **drain field options** available to home or business owners, and knowing what option is best for you is dependent on a number of factors. What might be best for one site and one property owner might not work as well or at all for another site, so it’s important to find the solution that works with your site rather than against it. In addition, many new options in septic treatment systems can improve the quality and purity of the effluent, which alters the requirements for the field and gives property owners even more drain field options. Many **drain field options** are tied to or limited by the local or state regulations on water quality. These generally specify minimum distances that must exist between a drain field and any local body of water, between the drain field and any structure, and between the bottom of the drain field and the water table. This ensures that proper percolation of the effluent can occur before encountering groundwater or other bodies of water. Other drain field options in size and layout depend on how effectively the effluent is treated and purified before getting to the drain field. Multiple-stage septic treatment systems, including aerobic septic systems, can improve the quality and purity of the effluent, generally requiring less overall space in the drain field to distribute the effluent in a way that ensures its treatment and purification before reaching the water table. At Southern Water and Soil, we have an experienced, cross-trained team that is well-versed in the many septic system and drain field options for our Odessa, FL customers. Let us help you today! --- *At Southern Water and Soil, we offer a variety of **drain field options** in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-options/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-options/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-options/), Miami, **[Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-options/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-options/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-options/), Florida.* --- ### [Drain Field Installation, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-drain-field/drain-field-installation/) **Published:** September 29, 2015 **Author:** Southern Water Soil **Content:** ## Drain field installation is one of the best ways to ensure a long-lasting and effective septic system for your Odessa, FL home or business. ![Drain Field Installation, Odessa, FL](/wp-content/uploads/2015/09/Drain-Field-Installation-300x169.jpg)One of the larger costs involved with a septic system is the **drain field installation**. The precise design of the drain field should be customized to your current and anticipated needs, as well as the soil type, septic system paired with the drain field, and the space on the property allotted for the drain field. Working from start to finish with a firm that understands the many options in septic systems available to residential and commercial property owners means that the drain field installation is a cog in a larger, well-built machine, promising an installation with minimal headache. Knowing your soil type, local regulations regarding drain field placement, your local water table, and the other components of the septic system, the proper drain field can be laid out. Once the setup of the drain field is determined, laying down the permeable substrate the drain field will rest on top of is key. A proper base for your drain field ensures that effluent is easily able to get to the soil in question, and determining the proper angle for best drainage and support for the pipes of the drain field is also crucial. Knowing the proper setup and placement of the field will help with the lawn over top, as well as avoiding complications due to growth from shrubs or trees, vehicles driving over the drain field, and biomat overgrowth. **Drain field installation** is one of the best ways to ensure a long-lasting and effective septic system for your home or business. At Southern Water and Soil, we have years of experience in helping our customers in Odessa, FL plan, install, and maintain their septic systems. Let us exceed your expectations today! --- *At Southern Water and Soil, we offer **drain field installation** services in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-installation/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-installation/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-installation/), Miami, **[Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-installation/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-installation/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-installation/), Florida.* --- ### [Commercial Septic Drain Field, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-drain-field/) **Published:** April 9, 2018 **Author:** Southern Water Soil **Content:** Content coming soon…. --- ### [Commercial Septic Drain Field, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-drain-field/) **Published:** April 9, 2018 **Author:** Southern Water Soil **Content:** ### Similar Services We Offer: --- ### [Package Plant Installations for Developments](https://southernsepticanddesign.com/why-choose-us/package-plant-installations-for-developments/) **Published:** February 17, 2016 **Author:** Southern Water Soil **Content:** ## Looking to install a septic system that works well for your property? Let us help! ![2015-08-18 14.32.20](https://b593516.assetcdn.net/593516/wp-content/uploads/2016/02/2015-08-18-14.32.20-300x169.jpg?lossy=1&strip=0&webp=1)At Southern Water and Soil, we offer a wide scope of septic services for developments. With over 30 years of experience in the business and many large-scale projects under our belts, our knowledge and credentials can simplify the wastewater treatment aspects of your project. We realize that not every building site is easily developed. Our knowledge of various codes and our use of up-to-date technology allow us to design, install, and maintain septic systems for lots on which others might not be able to do so. At Southern Water and Soil, we have over three decades of experience performing package plant installations in Tampa, Florida and are committed to your complete satisfaction. **✔** We are fully licensed, bonded, and insured. **✔** We provide accurate proposals and quotes that take into account a wide range of factors, such as the material costs, the type of system being installed, and the cost of installation. **✔** We make sure that all of the septic systems we design and install meet the requirements dictated by local authorities in the area. **✔** We always educate our clients on different system components and how ours positively differ in quality. **✔** We have partnered with several top-of-the-line manufacturers, like Orenco. ### **Call [(813) 785-0500](tel:+1-813-785-0500) or fill out our form to send an inquiry.** ![20130825_142223 (1)](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) ![2015-11-24 11.46.54 (1)](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) ![2015-11-24 11.58.34 (1)](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) ### ### Package Plant Installations "\*" indicates required fields Δ Your Name\* Your Email\* Phone No.\* Address\* City\* Zip Code\* Your Message\* --- ### [Distributed Wastewater Treatment Units, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/distributed-wastewater-treatment-units/) **Published:** June 5, 2025 **Author:** Southern Water Soil **Content:** ## We offer professional design and installation of distributed wastewater treatment units. At Southern Water and Soil, we provide professional design and installation services for **distributed wastewater treatment units**, offering dependable wastewater management solutions for properties without access to municipal sewer systems. These systems are a practical option for many types of properties, including subdivisions, mobile home parks, and other multi-user developments here in the **Dade City, Florida** area. ![Distributed Wastewater Treatment Units in Dade City, Florida](/wp-content/uploads/2025/06/20220303_154759-res.jpg) Distributed wastewater treatment units are engineered to treat and manage wastewater at or near the point of generation using a network of smaller, interconnected systems. Unlike a traditional single septic tank, these systems are scalable and can be customized to handle varying wastewater volumes, depending on the demands of the site. Our team designs every system based on site-specific factors, such as soil conditions, projected flow rates, and property layout. Our process begins with a comprehensive site evaluation and soil testing. From there, we develop a detailed system design that meets all local and state code requirements. Our licensed installers then handle every aspect of construction, from excavation to final system startup. Regulatory compliance is critical for distributed wastewater treatment system projects. We coordinate closely with local health departments and permitting agencies to make sure all applications, designs, and installations are fully approved before construction begins. Our experience working with regulators means fewer delays and a smoother process for our clients. If you are planning a development or upgrading an existing wastewater system, we have the expertise to deliver a dependable distributed wastewater treatment unit tailored to your property’s specific needs. [Contact us today](/contact-southern-water-and-soil/) to schedule a site visit to discuss your project and learn more about our work with **distributed wastewater treatment units**. --- *At Southern Water and Soil, we offer **distributed wastewater treatment units** in Brooksville, [**Dade City**](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-units/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-units/), and Tampa, Florida.* ### Similar Services We Offer: --- ### [Distributed Wastewater Treatment Unit Designs, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/distributed-wastewater-treatment-unit-designs/) **Published:** June 5, 2025 **Author:** Southern Water Soil **Content:** ## We put together effective distributed wastewater treatment unit designs. At Southern Water and Soil, we are a well-known residential septic designer and installer here in the **Dade City, Florida** area. Over the years, we have seen an uptick in the demand for **distributed wastewater treatment unit designs**, especially in areas lacking centralized sewer infrastructure. ![Distributed Wastewater Treatment Unit Designs in Dade City, Florida](/wp-content/uploads/2025/06/20150214_090751-res.jpg) These systems boast flexible, site-specific wastewater solutions that are ideal for residential developments, rural properties, and smaller communities. One of the things that sets distributed wastewater treatment units apart is that they can handle varying flow rates and challenging site conditions, such as high groundwater, poor soil percolation, or limited space, all while providing reliable treatment performance. When working on distributed wastewater treatment unit designs, we start with a thorough site assessment, which includes soil tests, surveys, and evaluating the available space for a drain field, a tank, or alternative dispersal methods. Depending on the constraints of the site, we might use an advanced treatment unit, such as an aerobic treatment system. From an installation standpoint, distributed wastewater treatment units can often reduce trenching and piping requirements, saving money on labor and materials. Some modular systems can be set up quickly and with minimal disturbance to the property. We also prioritize ease of access for service and maintenance, which are important factors for both homeowners and service providers. A well-designed distributed wastewater treatment unit means fewer headaches, predictable performance, and compliance with local codes. [Contact us today](/contact-southern-water-and-soil/) to learn more about the **distributed wastewater treatment unit designs** we put together. --- *At Southern Water and Soil, we offer **distributed wastewater treatment unit designs** in Brooksville, [**Dade City**](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-unit-designs/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-unit-designs/), and Tampa, Florida.* ### Similar Services We Offer: --- ### [Distributed Wastewater Treatment Systems, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/) **Published:** February 16, 2026 **Author:** Southern Water Soil **Content:** ## Distributed wastewater treatment systems are comparable to what most municipal plants use, but on a smaller scale. Wastewater treatment doesn’t look the same from one project to another. It takes significant experience and attention to innovations in the industry to be able to come up with reliable solutions. At Southern Water and Soil, we have over three decades of experience performing package plant installations in the **Spring Hill, Florida** area. We know it is important to offer options such as **distributed wastewater treatment systems** and to ensure that you are fully aware of how your new system will function. ![Distributed Wastewater Treatment Systems in Spring Hill, Florida](/wp-content/uploads/2022/04/20220303_154759-res.jpg) Distributed wastewater treatment systems are comparable to what most municipal plants use, but on a smaller scale. One of the biggest benefits of these systems is that there isn’t a need for a large-scale collection system. This means your initial capital investment will be lower. In addition, since the maintenance and operational costs are lower, you’ll save money going forward too. We can scale distributed wastewater treatment systems to any situation. There are many other benefits of **distributed wastewater treatment systems**, including environmental advantages. We are happy to meet with you to go over how these systems work and help you determine if installing one is the right option for your commercial or other development project. Our experience with septic engineering makes us an ideal choice if you are looking for a customized result that fits your objectives. We design, obtain permitting, and install all types of package plant systems. [Contact us](/contact-southern-water-and-soil/) today with any questions you might have or to schedule a consultation appointment. --- *At Southern Water and Soil, we offer **distributed wastewater treatment systems** in [Brooksville](/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/), [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/), [Fort Myers](/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/), Land O’ Lakes, Lutz, [Miami](/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/), [Odessa](/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/), Orlando, Plant City, Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/)**, and [Tampa](/distributed-wastewater-treatment-systems-tampa-fl/), [Florida](/commercial-septic-florida/distributed-wastewater-treatment-systems/).* ### Similar Services We Offer: --- ### [Distributed Wastewater Treatment System Permits, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/distributed-wastewater-treatment-system-permits/) **Published:** June 5, 2025 **Author:** Southern Water Soil **Content:** ## We can acquire the permits needed for distributed wastewater system installations. Designing and engineering high-performance septic systems is what we do here at Southern Water and Soil. We specialize in designing and installing distributed wastewater treatment systems, which are ideal for developments where centralized sewer access is unavailable or impractical. Whether you are managing a multi-unit residential site or a small community, a properly designed distributed wastewater treatment system offers a reliable wastewater solution. ![Distributed Wastewater Treatment System Permits in Dade City, Florida](/wp-content/uploads/2025/06/20140109_112304-res.jpg) Permitting is one of the most important steps in any distributed wastewater treatment system project. Our team works closely with property owners, engineers, and local regulatory agencies to ensure every system we install here in the **Dade City, Florida** area meets applicable permitting requirements. These permits typically involve detailed site evaluations, soil testing, system design reviews, and compliance with local and state health codes. In most cases, distributed systems must also meet specific performance standards, monitoring protocols, and reporting requirements. We handle the entire process for acquiring **distributed wastewater treatment system permits** on your behalf. From preparing the necessary documentation to submitting applications and coordinating with inspectors, we will put our years of experience navigating state and county regulations to work for you. This way, your project stays on track and in compliance from day one. When it comes to distributed wastewater treatment system permits, we can answer any of your questions and help with all phases of the permitting process for a successful project. For more information about **distributed wastewater treatment system permits** or to start your project, [get in touch with us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we handle the entire process for acquiring **distributed wastewater treatment system permits** in Brooksville, [**Dade City**](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/distributed-wastewater-treatment-system-permits/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/distributed-wastewater-treatment-system-permits/), and Tampa, Florida.* --- ### [Commercial Septic Permits, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/commercial-septic-permits/) **Published:** February 16, 2026 **Author:** Southern Water Soil **Content:** ## It is important to go through the proper channels when obtaining commercial septic permits, so your business can get off the ground without delays. Breaking ground on any commercial business site is exciting and may have been planned for many months or years. Commercial construction always requires planning and forethought, and that includes determining the best solutions for wastewater management at the site. Especially if your new business location will not be on the city sewer system, you’ll want to work with a knowledgeable team to address wastewater management concerns for both the short and long-term. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) At Southern Water and Soil, we are knowledgeable about commercial business wastewater management systems, and we can direct you through the necessary steps when it comes to obtaining the proper **commercial septic permits** in **Spring Hill, Florida**. It is important to go through the proper channels when obtaining commercial septic permits, so your business can get off the ground without delays. Our team can help you through the process from start to finish. Just like residential permits, commercial septic permits must accommodate the amount of wastewater that is expected to go through the system for any given timeframe. Commercial permits are different, however, depending on the type of business operation and any specific wastewater management requirements on the site. For example, commercial septic permits must outline any hazardous materials that may be transferred via the septic system. The good news is that our team here at Southern Water and Soil can go through every step and address any potential problems that arise as part of the commercial septic permitting process. We are also knowledgeable about jurisdictions and creating the ideal timeline for installation and inspections. [Contact us today](/contact-southern-water-and-soil/) for more information about **commercial septic permits** and to see how our services meet the needs of your commercial business in Spring Hill. --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-permits/), [Dade City](/commercial-septic-brandon/commercial-septic-permits/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-permits/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/), Orlando, Plant City, Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/)**, or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), [Florida](/commercial-septic-florida/commercial-septic-permits/).* ### Similar Services We Offer: --- ### [Commercial Septic Permit Application, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-permits/commercial-septic-permit-application/) **Published:** August 17, 2017 **Author:** Southern Water Soil **Content:** ## You’ll need to acquire a commercial septic permit application to get approved by the Florida Department of Health for septic installation in Tampa. ![Commercial Septic Permit Application in Tampa, Florida](/wp-content/uploads/2017/08/commercialseptic-application.jpg) At Southern Water and Soil, we know there are a lot of details to cover when it comes to adding a septic system to your property in Tampa, Florida. One of the most important items that you’ll need to acquire is a **commercial septic permit application** so you can get approved by the Florida Department of Health for the installation of this important system. There are several important steps to follow as you attain your septic installation approval, and our team is knowledgeable about this process so you can more easily achieve your goals. - The first step in obtaining your commercial septic permit application is to visit the Florida Department of Health office in your county. They will be able to inform you about state and county ordinances and regulations that you’ll need to adhere to before ground-breaking on your septic system begins. - Once you have obtained your commercial septic permit application, you’ll need to complete the required paperwork and submit it for approval, along with a site plan, building floor plan, and the required application fee. - You’ll also need to schedule a site evaluation before your commercial septic permit application can be approved. This will allow the Florida Department of Health to determine the construction and septic requirements for your property. At Southern Water and Soil, we can direct you to the proper authorities for your commercial septic permit application, provide the necessary documentation as part of your application, and assist you with your site evaluation. You can also find some additional information about the [requirements for your **commercial septic permit application**](https://www.floridahealth.gov/environmental-health/onsite-sewage/ostds-permitting.html) on the Florida Department of Health website. --- *At Southern Water and Soil, we can help with **commercial septic permit applications** in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-permits/commercial-septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/commercial-septic-permit-application/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/commercial-septic-permit-application/), and [**Tampa**](/commercial-septic-tampa-fl/commercial-septic-permits/commercial-septic-permit-application/), Florida.* --- ### [Commercial Septic Permit Application, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-permits/commercial-septic-permit-application/) **Published:** March 23, 2026 **Author:** Southern Water Soil **Content:** ## We can help you acquire the necessary permits for your new commercial septic system. ![Commercial Septic Permit Application in Odessa, Florida](/wp-content/uploads/2017/09/commercialseptic-application.jpg)If you’re breaking ground on a new commercial facility here in the **Odessa, Florida** area, it’s crucial to get your **commercial septic permit application** submitted as soon as possible. By the time your building is ready to open its doors to the public, you’ll want to ensure that your wastewater treatment system is operating safely, reliably, and efficiently. Fortunately, our dedicated local team at Southern Water and Soil is here to help you through each step of the commercial septic permit application process. With over 30 years of combined experience in the septic industry, our professionals are deeply familiar with the local laws, regulations, and permit requirements throughout this area. We’re more than ready to answer any questions you may have, assess your property, and help you through the application process. We have helped countless business owners fill out and submit commercial septic permit applications over the years, and we’re confident that we can give you the information you need in no time. Once we help you fill out your commercial septic permit application, we can work with you to design and install your new system as soon as your application is approved. Our team will thoroughly inspect your landscape and come up with an efficient and reliable system that will be able to reliably manage your typical wastewater processing needs. We’ll ask you about your company’s water usage habits, how many people will be in your building during peak hours, and other information to ensure that we customize the ideal solution for you. If you have questions about the **commercial septic permit application** process, know that you don’t need to struggle through it alone. Instead, you can turn to us to get the friendly, professional support you deserve. [Contact us today](/contact-southern-water-and-soil/) to get started! --- *At Southern Water and Soil, we can help with **commercial septic permit applications** in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-permits/commercial-septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, **[Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/commercial-septic-permit-application/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/commercial-septic-permit-application/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/commercial-septic-permit-application/), Florida.* --- ### [Commercial Septic Permit Application, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-permits/commercial-septic-permit-application/) **Published:** May 21, 2025 **Author:** Southern Water Soil **Content:** ## We can help you acquire the necessary permits for your new commercial septic system. ![Commercial Septic Permit Application in Dade City, Florida](/wp-content/uploads/2017/09/commercialseptic-application.jpg)If you’re breaking ground on a new commercial facility here in the **Dade City, Florida** area, it’s crucial to get your **commercial septic permit application** submitted as soon as possible. By the time your building is ready to open its doors to the public, you’ll want to ensure that your wastewater treatment system is operating safely, reliably, and efficiently. Fortunately, our dedicated local team at Southern Water and Soil is here to help you through each step of the commercial septic permit application process. With over 30 years of combined experience in the septic industry, our professionals are deeply familiar with the local laws, regulations, and permit requirements throughout this area. We’re more than ready to answer any questions you may have, assess your property, and help you through the application process. We have helped countless business owners fill out and submit commercial septic permit applications over the years, and we’re confident that we can give you the information you need in no time. Once we help you fill out your commercial septic permit application, we can work with you to design and install your new system as soon as your application is approved. Our team will thoroughly inspect your landscape and come up with an efficient and reliable system that will be able to reliably manage your typical wastewater processing needs. We’ll ask you about your company’s water usage habits, how many people will be in your building during peak hours, and other information to ensure that we customize the ideal solution for you. If you have questions about the **commercial septic permit application** process, know that you don’t need to struggle through it alone. Instead, you can turn to us to get the friendly, professional support you deserve. [Contact us today](/contact-southern-water-and-soil/) to get started! --- *At Southern Water and Soil, we can help with **commercial septic permit applications** in Brooksville, [**Dade City**](/commercial-septic-dade-city-fl/commercial-septic-permits/commercial-septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/commercial-septic-permit-application/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/commercial-septic-permit-application/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/commercial-septic-permit-application/), Florida.* --- ### [Septic System Diagnostic Specialist](https://southernsepticanddesign.com/specials/septic-system-diagnostic-specialist/) **Published:** June 26, 2024 **Author:** Southern Water Soil **Content:** ## Tired of Feeling Mystified with Your Septic System? # We Can Help You Understand Your Options! [Contact Us](#form-header4) ### Contact Our Septic Diagnostic Specialists! Septic tank alarm going off? Drain field not operating properly? Lift station not working? Make us your first call! We can conduct a comprehensive analysis of what your operations are based on your specific septic system. We also offer a competitive diagnostic rate, so contact us today! ### Here’s what you need to know about our septic diagnostic appointments: W We have a deep understanding of all things septic, including how they operate and the health department’s requirements. W We avoid looking at septic system issues as cookie cutter problems, so that we can offer you expert advice on septic system maintenance, repair, and overall system health. W All pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* “Greg came out and looked at my system. SWS gave me all the the options. These guys are the real deal!” – Erica S. ![](/wp-content/uploads/2023/03/stars-1.svg) #### Contact Us to Set Up an Appointment Once you set up an appointment, one of our experts will come and take a look and let you know how to get your septic system back on track. Contact us now to book your appointment! "\*" indicates required fields Δ Your Name\* Your Email\* Phone No.\* Address\* City\* Zip Code\* Your Message\* --- ### [Septic System Inspections, Dade City, FL](https://southernsepticanddesign.com/septic-inspections-dade-city-fl/septic-system-inspections/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## Hire us to inspect your septic system. Septic systems are a type of system designed to dispose of and treat wastewater. If your home or business relies on a septic system for wastewater disposal and management, it is essential that you have it inspected on a regular basis to identify issues early on before they turn into major problems. ![Septic System Inspections in Dade City, Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/04/Xq8uAYl4-res.jpeg?lossy=1&strip=0&webp=1) If you are looking for a professional who performs **septic system inspections** here in the **Dade City, Florida** area, reach out to us at Southern Water and Soil. We perform comprehensive septic system inspections, and we are well-known for our excellent customer service and workmanship. When should you have your septic system inspected? We recommend having your existing septic system inspected every few years to identify issues. An inspection can also help you plan for a future replacement and determine when this replacement should occur. We also highly recommend septic system inspections before the purchase or sale of a property. For example, if you are buying a home with a septic system, make sure you have a professional inspect it prior to purchase to ensure the system does not have any major problems. You should also have your septic system inspected before you sell your property, so you can become aware of any repairs you need to do before finalizing the sale. We provide detailed information about the septic system at hand during every septic system inspection, so that informed decisions can be made about the system’s basic care. To find out more about our **septic system inspections** and the process we follow, [contact us](/contact-southern-water-and-soil/) today. ### What kind of septic inspection do you need? ### ESSENTIAL SEPTIC SYSTEM INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess whether or not a pump is recommended - We will provide an estimate of the size and the volume of the tank - We will provide an estimate of the drain field size - We will provide a basic septic system report card on our visual inspection Essential Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* ### ENHANCED SEPTIC INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess what’s in there - We will pump the septic tank (scheduling TBD at a later date) - We will provide a thorough camera inspection on both the septic tank and drain field - We will provide a detailed measurement of the tank size & volume - We will provide a detailed measurement of drain field size & overall functionality - We will provide a thorough written report of septic system and the state of the drainfield’s structure and health based on our visual & camera inspections Enhanced Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* *\*We will confirm pricing to the best of our ability when your booking is confirmed.* *\*Parts and repairs extra.* *At Southern Water and Soil, we perform **septic system inspections** in [Brooksville](/septic-inspections-brooksville-fl/septic-system-inspections/), [**Dade City**](/septic-inspections-dade-city-fl/septic-system-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/septic-inspections-spring-hill-fl/septic-system-inspections/), and [Tampa](/septic-inspections-tampa-fl/septic-system-inspections/), Florida.* ### Contact Us to Schedule a Septic Inspection Δ - - - - Name\* - Email\* - Phone\* - Address of Septic System Inspection\* Street Address City ZIP / Postal Code - Are you a\* - Buyer - Seller - Agent - Septic Inspection Package\* - Basic - Advanced - Requested Date for Septic Inspection\* MM slash DD slash YYYY - - ### Similar Services We Offer: --- ### [Septic Inspections, Dade City, FL](https://southernsepticanddesign.com/septic-inspections-dade-city-fl/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## We know exactly what to look for when performing septic inspections. If you’re considering purchasing a property in the **Dade City, Florida** area, you probably know the importance of doing your due diligence. A property inspection is typically part of the process. But if the property has a septic system, it’s important to invest in a separate inspection. The average home inspector usually doesn’t have the knowledge or experience needed to assess the septic system’s most vital components, which is why it’s worthwhile to have our team at Southern Water and Soil perform the inspection. We know exactly what to look for when performing **septic inspections**. ![Septic Inspections](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/05/IMAG1003-res.jpg?lossy=1&strip=0&webp=1) One of the key elements we assess when tackling septic inspections is whether the system has been properly maintained. A lack of maintenance often creates expensive problems down the road, so it’s important to know that the system is functional and ready for use. If the tank hasn’t been pumped out regularly, it could crack or overflow, which leads to backup. A poorly maintained drain field can also become a serious problem that threatens the safety of the water table and surrounding land. Our technicians can determine whether a septic system has been cared for properly and if there are any underlying issues. Having us perform an inspection can save you a lot of time and trouble, as you’ll know what to expect with the septic system rather than going into a purchase without understanding the system’s condition. We can perform **septic inspections** on both residential and commercial properties, so [contact us](/contact-southern-water-and-soil/) to schedule your inspection. [![Everything You Need to Know About Our Septic System Inspections](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==)](/septic-services-blog/everything-you-need-to-know-about-our-septic-system-inspections-infographic/) ### What kind of septic inspection do you need? ### ESSENTIAL SEPTIC SYSTEM INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess whether or not a pump is recommended - We will provide an estimate of the size and the volume of the tank - We will provide an estimate of the drain field size - We will provide a basic septic system report card on our visual inspection Essential Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* ### ENHANCED SEPTIC INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess what’s in there - We will pump the septic tank (scheduling TBD at a later date) - We will provide a thorough camera inspection on both the septic tank and drain field - We will provide a detailed measurement of the tank size & volume - We will provide a detailed measurement of drain field size & overall functionality - We will provide a thorough written report of septic system and the state of the drainfield’s structure and health based on our visual & camera inspections Enhanced Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* *\*We will confirm pricing to the best of our ability when your booking is confirmed.* *\*Parts and repairs extra.* *At Southern Water and Soil, we perform **septic inspections** in [Brooksville](/septic-inspections-brooksville-fl/), [**Dade City**](/septic-inspections-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-inspections-odessa-fl/), Orlando, Plant City, [Spring Hill](/septic-inspections-spring-hill-fl/), and [Tampa](/septic-inspections-tampa-fl/), Florida.* ### Contact Us to Schedule a Septic Inspection Δ - - - - Name\* - Email\* - Phone\* - Address of Septic System Inspection\* Street Address City ZIP / Postal Code - Are you a\* - Buyer - Seller - Agent - Septic Inspection Package\* - Basic - Advanced - Requested Date for Septic Inspection\* MM slash DD slash YYYY - - ### Similar Services We Offer: --- ### [Master Septic Contractor Inspections, Dade City, FL](https://southernsepticanddesign.com/septic-inspections-dade-city-fl/master-septic-contractor-inspections/) **Published:** May 9, 2023 **Author:** Southern Water Soil **Content:** ## As a master septic contractor, we can thoroughly inspect your septic system. Regular septic inspections can identify issues and opportunities for improvement. But the findings of a septic inspection are only as accurate and helpful as they can be when the person doing the inspection is qualified. If you want to have your septic system in **Dade City, Florida** inspected, it is important for an experienced, qualified professional to take care of this process. ![Master Septic Contractor Inspections in Dade City, FL](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/04/Xq8uAYl4-res.jpeg?lossy=1&strip=0&webp=1) At Southern Water and Soil, we perform **master septic contractor inspections** in the area, and we can provide you with further information about the operation and condition of your existing system. As a master septic contractor, we can perform many types of inspections. For example, we can perform initial site evaluations, installation inspections, routine maintenance inspections, and repair and upgrade inspections. Our **master septic contractor inspections** are comprehensive and provide all the information needed to make informed, confident decisions about your septic system. We can evaluate if a septic system is suitable for a piece of property, check that a septic system installation meets all relevant codes and regulations, identify signs of damage or issues that could affect a septic system’s performance, and assess a repair situation and provide recommendations for the best course of action. Master septic contractor inspections are a key element of maintaining your septic system and ensuring its operation and efficiency for years to come. To schedule your next inspection or to learn more about our inspection process, [reach out](/contact-southern-water-and-soil/) to our team today. ### What kind of septic inspection do you need? ### ESSENTIAL SEPTIC SYSTEM INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess whether or not a pump is recommended - We will provide an estimate of the size and the volume of the tank - We will provide an estimate of the drain field size - We will provide a basic septic system report card on our visual inspection Essential Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* ### ENHANCED SEPTIC INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess what’s in there - We will pump the septic tank (scheduling TBD at a later date) - We will provide a thorough camera inspection on both the septic tank and drain field - We will provide a detailed measurement of the tank size & volume - We will provide a detailed measurement of drain field size & overall functionality - We will provide a thorough written report of septic system and the state of the drainfield’s structure and health based on our visual & camera inspections Enhanced Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* *\*We will confirm pricing to the best of our ability when your booking is confirmed.* *\*Parts and repairs extra.* ### Contact Us to Schedule a Septic Inspection Δ - - - - Name\* - Email\* - Phone\* - Address of Septic System Inspection\* Street Address City ZIP / Postal Code - Are you a\* - Buyer - Seller - Agent - Septic Inspection Package\* - Basic - Advanced - Requested Date for Septic Inspection\* MM slash DD slash YYYY - - --- ### [Drain Field Inspections, Dade City, FL](https://southernsepticanddesign.com/septic-inspections-dade-city-fl/drain-field-inspections/) **Published:** April 13, 2023 **Author:** Southern Water Soil **Content:** ## Have our professionals inspect your drain field. Your drain field is one of the most important parts of your septic system. This system is responsible for treating and disposing of the wastewater that comes from your home by relying on a series of underground pipes. These pipes are surrounded by a layer of aggregate or gravel, which provides additional surface area for wastewater treatment. ![Drain Field Inspections in Dade City, Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/04/zpx1J1xQ-res.jpeg?lossy=1&strip=0&webp=1) Once effluent arrives at your drain field, the soil acts as a natural filter, removing harmful bacteria and other contaminants from your wastewater. This treated wastewater eventually enters the groundwater or is absorbed by surrounding plant roots. Because your drain field is a critical part of your septic system, it is important to ensure it is always in good condition. If you’re not sure where to turn for assistance, our team is available to help with this process here at Southern Water and Soil. We perform professional **drain field inspections** throughout the **Dade City, Florida** area, and we can help you maintain a reliable, safe, and effective drain field. During our drain field inspections, we thoroughly look over all parts of the drain field to make sure that everything is in good condition. If we find something that needs to be fixed, we will include our recommendations in our final report. After giving the client our report, we can begin our repairs as soon as they give us their approval. As septic professionals with years of experience behind us, we know exactly how to properly inspect and repair drain fields. [Contact us](/contact-southern-water-and-soil/) today to learn more about **drain field inspections** and to schedule your next septic appointment with us. ### What kind of septic inspection do you need? ### ESSENTIAL SEPTIC SYSTEM INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess whether or not a pump is recommended - We will provide an estimate of the size and the volume of the tank - We will provide an estimate of the drain field size - We will provide a basic septic system report card on our visual inspection Essential Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* ### ENHANCED SEPTIC INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess what’s in there - We will pump the septic tank (scheduling TBD at a later date) - We will provide a thorough camera inspection on both the septic tank and drain field - We will provide a detailed measurement of the tank size & volume - We will provide a detailed measurement of drain field size & overall functionality - We will provide a thorough written report of septic system and the state of the drainfield’s structure and health based on our visual & camera inspections Enhanced Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* *\*We will confirm pricing to the best of our ability when your booking is confirmed.* *\*Parts and repairs extra.* *At Southern Water and Soil, we perform **drain field inspections** in [Brooksville](/septic-inspections-brooksville-fl/drain-field-inspections/), [**Dade City**](/septic-inspections-dade-city-fl/drain-field-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/septic-inspections-tampa-fl/drain-field-inspections/), Florida.* ### Contact Us to Schedule a Septic Inspection Δ - - - - Name\* - Email\* - Phone\* - Address of Septic System Inspection\* Street Address City ZIP / Postal Code - Are you a\* - Buyer - Seller - Agent - Septic Inspection Package\* - Basic - Advanced - Requested Date for Septic Inspection\* MM slash DD slash YYYY - - --- ### [Book a Septic Inspection!](https://southernsepticanddesign.com/book-a-septic-inspection/) **Published:** April 11, 2023 **Author:** Southern Water Soil **Content:** ## Are You Buying or Selling a Home or Business? # Book a Septic Inspection! If you’re buying or selling a home or business, we can help you with a septic inspection. While some contracts have a septic inspection built in, you should always schedule an inspection before your deal closes. Contact us today to get our professionals on the job! [BOOK NOW](#form-header4) ### Here are the top reasons to have a septic inspection done before you sign on the dotted line: ![elements of the system](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/04/iStock-170025651-offer.jpg?lossy=1&strip=0&webp=1) Make sure all the elements of the system are in working order, wired, and plumbed correctly ![type of system](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) Provide a clear layout of the type of system on the property, including the size of the tank, overall condition, and whether repairs are needed ![existing septic system](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) Uncover considerations regarding the health and longevity of the existing septic system ### What kind of septic inspection do you need? ### ESSENTIAL SEPTIC SYSTEM INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess whether or not a pump is recommended - We will provide an estimate of the size and the volume of the tank - We will provide an estimate of the drain field size - We will provide a basic septic system report card on our visual inspection Essential Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* ### ENHANCED SEPTIC INSPECTION - We will locate your system components if that is unknown - We will provide a visual inspection - We will open up the tank and visually assess what’s in there - We will pump the septic tank (scheduling TBD at a later date) - We will provide a thorough camera inspection on both the septic tank and drain field - We will provide a detailed measurement of the tank size & volume - We will provide a detailed measurement of drain field size & overall functionality - We will provide a thorough written report of septic system and the state of the drainfield’s structure and health based on our visual & camera inspections Enhanced Septic System Inspections pricing is based on the size of the system and proximity within our service area. Please inquire for our up-to-date rates.\* *\*We will confirm pricing to the best of our ability when your booking is confirmed.* *\*Parts and repairs extra.* ### Contact Us to Schedule a Septic Inspection Δ - - - - Name\* - Email\* - Phone\* - Address of Septic System Inspection\* Street Address City ZIP / Postal Code - Are you a\* - Buyer - Seller - Agent - Septic Inspection Package\* - Basic - Advanced - Requested Date for Septic Inspection\* MM slash DD slash YYYY - - --- ### [Privacy Policy](https://southernsepticanddesign.com/privacy-policy/) **Published:** August 5, 2015 **Author:** Southern Water Soil **Content:** We want you to know how seriously we take your privacy, so please read our privacy policy, which we’re sure will address any worries you may have: If you submit your information we’ll keep it for the purposes of contacting you and we won’t share it with anyone else. We don’t spam…but if you submit your email address to us you may receive an email from us from time to time. You will have the option to unsubscribe from these at any time. We don’t: • Sell, lease or otherwise disseminate your information • Contact you after you have unsubscribed from our email list We do: • Use your feedback to make our sites and customer service better • Use cookies (more details below!) • Encrypt sensitive data and use other methods to protect your particulars Here’s a bit more from our legal friends: Third party links Occasionally, at our discretion, we may include or offer third party products or services on our website. These third party sites have separate and independent privacy policies. We therefore have no responsibility or liability for the content and activities of these linked sites. Nonetheless, we seek to protect the integrity of our site and welcome any feedback about these sites. Online Privacy Policy Only This online privacy policy applies only to information collected through our website and not to information collected offline. Microsoft Clarity *We partner with Microsoft Clarity and Microsoft Advertising to capture how you use and interact with our website through behavioral metrics, heatmaps, and session replay to improve and market our products/services. Website usage data is captured using first and third-party cookies and other tracking technologies to determine the popularity of products/services and online activity. Additionally, we use this information for site optimization, fraud/security purposes, and advertising. For more information about how Microsoft collects and uses your data, visit the [Microsoft Privacy Statement](https://www.microsoft.com/en-US/privacy/privacystatement).* Your Consent By using our site, you consent to our privacy policy. Cookie Policy As you browse our site, advertising cookies will be placed on your computer so that we can understand what you are interested in. Our display advertising partner, AdRoll, then enables us to present you with retargeting advertising on other sites based on your previous interaction on our site. The techniques our partners employ do not collect personal information such as your name, email address, postal address, or telephone number. Please contact us if you have questions about our use of cookies or to opt out of AdRoll’s and their partners’ targeted advertising. To opt out of interest-based advertising such as adroll retargeting please click the following link and click the buttons for browser and/or mobile opt-outs to opt out of each. Changes to our Privacy Policy If we decide to change our privacy policy, we will post those changes on this page. This policy was last modified on 20-MAY-2026 Contacting Us If there are any questions regarding this privacy policy you may contact us at southernwatersoil@gmail.com --- ### [Contact Southern Water and Soil, Dade City, FL](https://southernsepticanddesign.com/contact-southern-water-and-soil/) **Published:** July 3, 2014 **Author:** Southern Water Soil **Content:** ## Contact us to discuss your septic project. If you are looking for an experienced company that offers quality septic engineering, design, and installation services throughout Florida, turn to us at Southern Water and Soil. We offer a wide range of services, including once-off permitting, inspections, and septic repair. Tell us more about about your requirements for your septic project – we work on both residential and commercial septic projects. Contact us today to set up a consultation with our experienced team, and we will put together an initial plan for moving forward. We look forward to hearing from you and to working on your septic project! "\*" indicates required fields Δ Name\* Phone\* Email\* Address\* City\* Zip Code\* Services\* Residential Commercial How can we help?\* ![Contact Southern Water and Soil](https://b593516.assetcdn.net/593516/wp-content/uploads/2015/06/CommunityWastewaterSystems.jpg?lossy=1&strip=0&webp=1) **Southern Water and Soil** ![Southern Water and Soil](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) 9852 Preakness Stakes Way Dade City, FL 33525 Telephone: [(813) 785-0500](tel:+1-813-785-0500) [Find us on Google](https://g.page/southern-water-and-soil) --- ### [About Southern Water and Soil, Dade City, FL](https://southernsepticanddesign.com/about-southern-water-and-soil/) **Published:** July 7, 2014 **Author:** Southern Water Soil **Content:** ## We have over 30 years of combined experience working on septic and wastewater projects. It is said that experience is a great teacher. When it comes to having your septic system installed or serviced by someone without a lot of experience, you will be taught a very expensive lesson. Don’t take chances on something so important; call our highly experienced septic and wastewater system experts at Southern Water and Soil. We have over 30 years of combined experience in septic and wastewater projects throughout Florida. ![2013-08-24-13.45.40](https://southernsepticanddesign.com/wp-content/uploads/2026/05/2013-08-24-13.45.40.jpg) For many years, our core focus was on designing and engineering septic systems of all sizes for buildings and homes both large and small. Today, we continue to manage every part of new [septic system design](/commercial-septic-tampa-fl/septic-system-design/), [engineering](https://southernsepticanddesign.com/septic-services-tampa-fl/septic-engineering/), and [installation](https://southernsepticanddesign.com/package-plant-installations-tampa-fl/), and we provide exceptional education to new septic owners on maintenance, so these systems continue to operate properly for years to come. Now, in addition to our design and engineering solutions, we also offer residential septic services. We have partnered with carefully vetted partners to provide these services under our experienced leadership team’s supervision. These services include septic replacements and installations, drain field work, septic inspections for real estate, septic system repairs, alarms, and septic tank pumping. Why should you choose us for all of your home or commercial site’s septic projects and service? One of our main differentiators as a full-service septic company is that we have certified environmental health professionals and Master Septic Contractors on staff. Our team members also possess the necessary credentials to ensure all septic systems we install and work on are up to code and will pass the permitting process. When you need [septic services](/septic-services-tampa-fl/) in the **Dade City, Florida** area, our team is here to provide experienced, knowledgeable, and personalized solutions. [Contact us today](/contact-southern-water-and-soil/) to set up your next appointment or consultation.  #### Check out the feature article in National Onsite Installer! [![Onsite Installer](https://southernsepticanddesign.com/wp-content/uploads/2014/07/cover-249x300.jpg)](/wp-content/uploads/2015/11/i0815_Profile_ATailoredFit.pdf) --- ### [NSF 245 Septic Systems, Dade City, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-dade-city-fl/nsf-245-septic-systems/) **Published:** June 28, 2023 **Author:** Southern Water Soil **Content:** ## We can install a nitrogen-reducing septic system on your property. When wastewater leaves your home, it’s treated in your drain field. But when water gets absorbed into your drain field and back into the groundwater, this process doesn’t remove nitrogen, which is a common byproduct in human waste. When high levels of nitrogen get into groundwater and other water sources, it can have devastating effects on the natural environment. If you are interested in installing a nitrogen-reducing septic system — also known as an Enhanced Nutrient-Reducing septic system, Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal System (ENR-OSTDS), or ENR septic system — on your property in **Dade City, Florida** to control the level of nitrogen in your area, we highly recommend **NSF 245 septic systems**. At Southern Water and Soil, we have installed NSF 245 septic systems at many homes successfully, and we are impressed by the way they effectively and efficiently remove nitrogen during the wastewater removal process. ![NSF 245 Septic Systems in Dade City, Florida](/wp-content/uploads/2023/06/20230517_120215-cover.jpg) When you turn to us and tell us you want to put a nitrogen-reducing septic system on your property, the first thing we will do is explore your options with you. Then, once you have tentatively decided on a system, we will survey your property and make plans for installation. On the day of installation, our crews will arrive ready to work and install your new septic system with precision. We would be happy to answer any questions you have about **NSF 245 septic systems**, how they work, and why they are a worthwhile investment. To set up an appointment with a member of our team or to find out more about nitrogen-reducing septic systems, [get in touch with us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **NSF 245 septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/nsf-245-septic-systems/), **[Dade City](/nitrogen-reducing-septic-system-dade-city-fl/nsf-245-septic-systems/)**, [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/nsf-245-septic-systems/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/nsf-245-septic-systems/), [Florida](/nitrogen-reducing-septic-system-florida/nsf-245-septic-systems/).* --- ### [Septic Engineering, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-engineering/) **Published:** April 18, 2017 **Author:** Southern Water Soil **Content:** ## Our septic engineering services begin with expert design of your septic system in Dade City. At Southern Water and Soil, we are ready to assist you with expert **septic engineering** at your home or business in Dade City, Florida. With over 30 years of combined experience in the residential and commercial septic industry, we are confident that you’ll achieve the best results when you work with our team on your septic system needs. ![Septic Engineering](/wp-content/uploads/2026/05/20140109_112309-res.jpg) Our septic engineering services begin with expert design of your septic system, including providing septic and drain field options that will suit your property best. We know that not every property is well-suited for a traditional septic system, and we provide the alternatives you need to get cost-effective, long-term use from your system each year. Once our septic design is complete, we’ll also provide the installation and maintenance solutions you need at your home or business. The only way septic engineering provides long-term results is if the installation and maintenance processes are completed as required. At Southern Water and Soil, we are committed to exceeding customer expectations and will keep you informed throughout the process, so you feel confident your septic system will meet your needs. When you rely on our skilled team at Southern Water and Soil for septic engineering, you will never have doubts that you will need septic services again too soon.[ Contact us](/contact-southern-water-and-soil/) today if you are looking for septic solutions, require new septic engineering and installation, or need repair and maintenance services in Dade City. Our comprehensive services will help you achieve the most from your septic system. We look forward to working with you. --- *At Southern Water and Soil, we offer **septic engineering** services in [Brooksville](/residential-septic-brooksville-fl/septic-engineering/), **[Dade City](/septic-services-brandon-fl/septic-engineering/)**, [Fort Myers](/residential-septic-fort-myers-fl/septic-engineering/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/septic-engineering/), [Odessa](/septic-services-odessa-fl/septic-engineering/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/septic-engineering/), and [Tampa](/septic-services-tampa-fl/septic-engineering/), [Florida](/residential-septic-florida/septic-engineering/).* ### Similar Services We Offer: --- ### [Commercial Septic Permits, Florida](https://southernsepticanddesign.com/commercial-septic-florida/commercial-septic-permits/) **Published:** August 21, 2023 **Author:** Southern Water Soil **Content:** ## Let us help with your new commercial septic system. Building your own business is an exciting but stressful endeavor. To ensure it goes smoothly, you need to check all the boxes, especially if your building will not be connected to the public sewer system. Getting **commercial septic permits** is essential in ensuring that waste is handled safely and your construction continues without delay. With over 30 years in the septic industry, our team at Southern Water and Soil can help you with your permit needs in **Florida**. Continue reading to understand why these permits are important. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) Obtaining commercial septic permits helps local officials keep an eye on and control the installation and maintenance of septic systems so that soil and water sources don’t get contaminated. The permit process typically includes the following things: - Site evaluations to find the best place for the septic system Assessment of soil type - Assessment of the amount of groundwater - Documentation of the distance from bodies of water In addition, to receive **commercial septic permits**, you must follow certain design standards and rules. This ensures that the system is built to meet the business’s needs and sanitary and environmental laws. Our team can not only design your system but also help you with the permit process. Ultimately, a commercial septic permit is more than just a formal requirement. It’s a way to improve public health, protect the environment, and ensure that businesses using septic systems can keep running smoothly. [Contact our team](/contact-southern-water-and-soil/) to learn about your need for a permit and how we can help. --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-permits/), [Dade City](/commercial-septic-brandon/commercial-septic-permits/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-permits/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/), or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), [**Florida**](/commercial-septic-florida/commercial-septic-permits/).* --- ### [Commercial Septic Permits, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-permits/) **Published:** August 17, 2017 **Author:** Southern Water Soil **Content:** ## We are knowledgeable about the requirements for commercial septic permits in Tampa and can help you attain the necessary approval. At Southern Water and Soil, we know that breaking ground on your commercial business site is exciting – and it also requires forethought and planning. If you are building in an area that is not connected to the city sewer system, you may be looking for **commercial septic permits** that will allow you to more easily manage your business’ wastewater treatment and disposal. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) As a reputable commercial septic company, at Southern Water and Soil, we are knowledgeable about the requirements for commercial septic permits and can help you attain the necessary documentation and approval before your commercial septic system is installed in Tampa, Florida. It’s important to go through the proper channels and to ensure that your business is set up for success from the ground up. **Commercial septic permits** are similar to residential permits in that they must accommodate the amount of wastewater that is expected to be transferred through the system at any given interval. However, commercial septic permits are differentiated by the type of business operation and whether there are any specific wastewater management requirements, such as hazardous materials that may be transferred without proper disposal. At Southern Water and Soil, we can address these issues, as well as any jurisdictional requirements during the commercial septic permitting process. Our ultimate goal is to make sure your commercial septic permits are approved accordingly and that you have the septic system design and installation that works best for your unique business requirements in Tampa. [Contact us](/contact-southern-water-and-soil/) today to learn more about this important step in the commercial septic installation process. --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-permits/), [Dade City](/commercial-septic-brandon/commercial-septic-permits/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-permits/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/), or **[Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/)**, [Florida](/commercial-septic-florida/commercial-septic-permits/).* ### Similar Services We Offer: --- ### [Commercial Septic Permits, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-permits/) **Published:** March 23, 2026 **Author:** Southern Water Soil **Content:** ## It is important to go through the proper channels when obtaining commercial septic permits, so your business can get off the ground without delays. Breaking ground on any commercial business site is exciting and may have been planned for many months or years. Commercial construction always requires planning and forethought, and that includes determining the best solutions for wastewater management at the site. Especially if your new business location will not be on the city sewer system, you’ll want to work with a knowledgeable team to address wastewater management concerns for both the short and long-term. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) At Southern Water and Soil, we are knowledgeable about commercial business wastewater management systems, and we can direct you through the necessary steps when it comes to obtaining the proper **commercial septic permits** in **Odessa, Florida**. It is important to go through the proper channels when obtaining commercial septic permits, so your business can get off the ground without delays. Our team can help you through the process from start to finish. Just like residential permits, commercial septic permits must accommodate the amount of wastewater that is expected to go through the system for any given timeframe. Commercial permits are different, however, depending on the type of business operation and any specific wastewater management requirements on the site. For example, commercial septic permits must outline any hazardous materials that may be transferred via the septic system. The good news is that our team here at Southern Water and Soil can go through every step and address any potential problems that arise as part of the commercial septic permitting process. We are also knowledgeable about jurisdictions and creating the ideal timeline for installation and inspections. [Contact us today](/contact-southern-water-and-soil/) for more information about **commercial septic permits** and to see how our services meet the needs of your commercial business in Odessa. --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-permits/), [Dade City](/commercial-septic-brandon/commercial-septic-permits/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-permits/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, **[Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/), or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), [Florida](/commercial-septic-florida/commercial-septic-permits/).* ### Similar Services We Offer: --- ### [Commercial Septic Permits, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-permits/) **Published:** August 20, 2020 **Author:** Southern Water Soil **Content:** ## We can walk you through the process of obtaining the necessary commercial septic permits for your construction project. With a state that is surrounded by water, it is sometimes easy to overlook that there is a complex water system under Florida, as well. With 29 major watersheds that are managed by five water management districts, it is critically important for the entire state to keep these waters uncontaminated. Part of that endeavor is regulating the process of waste management, particularly with business entities. This is one reason why **commercial septic permits** are required when putting in a system in the **Lutz, Florida** area. At Southern Water and Soil, we understand the jurisdictional requirements during the process of obtaining commercial septic permits and can help you get the approval you need to commence work on your commercial project. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) We can help you go through the proper channels and obtain the necessary documentation so that your construction project doesn’t come to a stand-still and delay the opening of your business. Missing deadlines can be costly and even make a project fail completely. With us helping you with your commercial septic permits, especially during the critical planning stage, we can help you keep your project moving along to be completed on time and on budget. We have the experience necessary to address the many factors that go into commercial septic permits, including determining how much wastewater the septic system must be able to handle, the types of materials you’ll be utilizing the septic system to filter, and the location on your property where the septic system is to be installed. If you have any questions about **commercial septic permits** or any of our services, don’t hesitate to [reach out to us](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-permits/), [Dade City](/commercial-septic-brandon/commercial-septic-permits/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-permits/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), **[Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/)**, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/), or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), [Florida](/commercial-septic-florida/commercial-septic-permits/).* --- ### [Commercial Septic Permits, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-permits/) **Published:** March 23, 2019 **Author:** Southern Water Soil **Content:** ## We have a thorough understanding of the process needed to successfully pull commercial septic permits. Just about everyone in the Land O’ Lakes, Florida area knows that there is very little you can do in the construction industry that doesn’t require a permit be applied for and approved. This is especially true when it comes to commercial properties where the wellbeing of the public must be considered. In the case of **commercial septic permits**, the reasons extend into the protection of the environment, as substandard waste disposal can prove a danger to the lifestyle that we all appreciate as Floridians. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) At Southern Water and Soil, we are experienced not only in the process of applying for **commercial septic permits**, but also installing systems that are safe for the public and our environment. There are many factors that need to be addressed to get a permit approved and for work to begin. We must put together the necessary documentation about your business operations, soil percolation rate in minutes per inch, anticipated building occupancies, and the number of linear feet needed to handle daily wastewater flow. In the end, the information provided when pulling commercial septic permits must match what has been installed so that the final inspection by the county goes smoothly. Of course, your having peace of mind that your septic system will function properly and safely is also important. If you would like to know more about the process of applying for commercial septic permits and what goes into the planning stage to ensure the best results, don’t hesitate to [contact us](/contact-southern-water-and-soil/) to schedule a consultation. --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-permits/), [Dade City](/commercial-septic-brandon/commercial-septic-permits/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-permits/), **[Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/)**, [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/), or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), [Florida](/commercial-septic-florida/commercial-septic-permits/).* --- ### [Commercial Septic Permits, Fort Meyers, FL](https://southernsepticanddesign.com/commercial-septic-fort-myers-fl/commercial-septic-permits/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## Our team makes it easy to get the commercial septic permits you need for your project. Everyone can agree that modern plumbing systems make life much more convenient and comfortable for everyone—after all, no one is eager to go back to the days of chamber pots and outhouses. In addition, modern plumbing systems, and the infrastructure they rely on have significantly improved public health. Because we now have water treatment systems to purify water and sewers to manage human waste, waterborne diseases such as cholera are now virtually unheard of. With this in mind, it’s easy to understand why governments require developers and construction companies to get permits before they install septic systems—they need to make sure the system meets certain standards, so it won’t fail and get people sick. If you require **commercial septic permits** for your project, our team at Southern Water and Soil can help. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) We have been working in this industry for over 30 years, so we are thoroughly familiar with the process of applying for commercial septic permits. You can count on our team to secure the permits as quickly as possible. We will also make sure our designs satisfy the officials from the start, and we’ll check every form before submission to ensure there are no mistakes. Then, once we have obtained the permits, we can take care of the septic installation process for you as well. Our team is proud to serve the community here in **Fort Meyers, Florida**, and we want to help you continue to develop this area. If you need **commercial septic permits** as part of your next construction project, [reach out to us](/contact-southern-water-and-soil/) to get our experts on the job. --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-permits/), [Dade City](/commercial-septic-brandon/commercial-septic-permits/), [**Fort Myers**](/commercial-septic-fort-myers-fl/commercial-septic-permits/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/), or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), [Florida](/commercial-septic-florida/commercial-septic-permits/).* --- ### [Commercial Septic Permits, Brooksville, FL](https://southernsepticanddesign.com/commercial-septic-brooksville-fl/commercial-septic-permits/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## You can rely on our team to guide you through the permits process and design a system that meets all standards. When planning a commercial property, one crucial component that needs to be addressed is the septic system. Ensuring that your septic system is correctly installed and in accordance with local standards is critical for both environmental preservation and the efficient functioning of your business. This is where the importance of following the correct channels for **commercial septic permits** becomes clear, and why having an experienced septic team like us at Southern Water and Soil on your side can make all the difference. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) To guarantee public health and environmental safety, all commercial septic systems must comply with strict regulatory standards. Local health departments and environmental organizations establish these standards, which include requirements for system design, installation, and maintenance. Failure to secure the required commercial septic permits can result in significant fines, legal penalties, and possibly the shutdown of your business. Unfortunately, navigating the process to acquire your commercial septic permits can be difficult, with numerous municipal, state, and federal laws to consider. The good news is that our team is familiar with these rules and can guide you in the right direction to make sure no steps are missed. This saves you time, reduces frustration, and gives you peace of mind knowing your system is compliant. Also, since we know the process, we can ensure your system is built to follow the standards. This includes conducting accurate soil testing, evaluating the property layout, and recommending the optimum system size and type for your waste management requirements. This precision makes it even easier to secure **commercial septic permits** and assures that your system will perform properly in the future. [Contact our team](/contact-southern-water-and-soil/) today in the **Brooksville, Florida** area to learn more. --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [**Brooksville**](/commercial-septic-brooksville-fl/commercial-septic-permits/), [Dade City](/commercial-septic-brandon/commercial-septic-permits/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-permits/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/), or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), [Florida](/commercial-septic-florida/commercial-septic-permits/).* --- ### [Commercial Septic Permits, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-permits/) **Published:** July 31, 2018 **Author:** Southern Water Soil **Content:** ## It is important to go through the proper channels when obtaining commercial septic permits, so your business can get off the ground without delays. Breaking ground on any commercial business site is exciting and may have been planned for many months or years. Commercial construction always requires planning and forethought, and that includes determining the best solutions for wastewater management at the site. Especially if your new business location will not be on the city sewer system, you’ll want to work with a knowledgeable team to address wastewater management concerns for both the short and long-term. ![Commercial Septic Permits](/wp-content/uploads/2026/05/20130825_075600-res.jpg) At Southern Water and Soil, we are knowledgeable about commercial business wastewater management systems, and we can direct you through the necessary steps when it comes to obtaining the proper **commercial septic permits** in Dade City, Florida. It is important to go through the proper channels when obtaining commercial septic permits, so your business can get off the ground without delays. Our team can help you through the process from start to finish. Just like residential permits, commercial septic permits must accommodate the amount of wastewater that is expected to go through the system for any given timeframe. Commercial permits are different, however, depending on the type of business operation and any specific wastewater management requirements on the site. For example, commercial septic permits must outline any hazardous materials that may be transferred via the septic system. The good news is that our team here at Southern Water and Soil can go through every step and address any potential problems that arise as part of the commercial septic permitting process. We are also knowledgeable about jurisdictions and creating the ideal timeline for installation and inspections. [Contact us today](/contact-southern-water-and-soil/) for more information about **commercial septic permits** and to see how our services meet the needs of your commercial business in Dade City. --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-permits/), [**Dade City**](/commercial-septic-brandon/commercial-septic-permits/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-permits/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/), or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), [Florida](/commercial-septic-florida/commercial-septic-permits/).* ### Similar Services We Offer: --- ### [Nitrogen-Reducing Septic System, Fort Myers, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-fort-myers-fl/) **Published:** May 28, 2023 **Author:** Southern Water Soil **Content:** ## Create a more sustainable and environmentally friendly future with a nitrogen-reducing septic system. At Southern Water and Soil, we don’t just talk about environmental sustainability and effective wastewater management—we actively integrate these principles into our innovative solutions such as **nitrogen-reducing septic systems,** also known as Enhanced Nutrient-Reducing septic systems, Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal Systems (ENR-OSTDS), or ENR septic systems. ![Nitrogen-Reducing Septic System](/wp-content/uploads/2026/05/20220303_154752-res.jpg) While generally efficient, traditional septic systems have a known shortcoming: they can lead to excess nitrogen in our groundwater. This can trigger environmental complications like algal blooms and diminished water quality, concerns that are increasingly coming into focus. To combat these challenges, we offer **nitrogen-reducing septic systems** to our clients. These modern marvels incorporate a unique process called denitrification, cleverly transforming wastewater nitrogen into harmless nitrogen gas. The results? A significant reduction in your environmental footprint, improved health of our water bodies, and a step towards a more sustainable community. Over the years, we have gained extensive experience in installing and maintaining these advanced systems. With this system, you can mitigate issues often associated with traditional systems, like well water contamination, and even leverage this as a compelling selling point if you decide to put your property on the market. We’re driven by a commitment to deliver a system that aligns with your needs—one that is designed with precision and that is installed with minimal disruption. Your satisfaction and the health of our shared environment is of the utmost importance to us. So why wait? [Reach out to us today](/contact-southern-water-and-soil/) and discover more about our nitrogen-reducing septic systems. Let’s work together to achieve your wastewater management goals in **Fort Myers, Florida** and create a more sustainable and environmentally friendly future. --- *At Southern Water and Soil, we install **nitrogen-reducing septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/), **[Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/)**, Land O’ Lakes, Lutz, Miami, [Odessa](/nitrogen-reducing-septic-system-odessa-fl/), [Orlando](/nitrogen-reducing-septic-system-orlando-fl/), Plant City, Wesley Chapel, [Spring Hill](/nitrogen-reducing-septic-system-spring-hill-fl/), and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/), [Florida](/nitrogen-reducing-septic-system-florida/).* ### Similar Services We Offer: --- ### [Nitrogen-Reducing Septic System, Florida](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-florida/) **Published:** June 27, 2023 **Author:** Southern Water Soil **Content:** ## We can service and install nitrogen-reducing septic systems. A **nitrogen-reducing septic system** — also known as an Enhanced Nutrient-Reducing septic system, Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal System (ENR-OSTDS), or ENR septic system — is designed to reduce the amount of nitrogen released into the environment from septic systems. Traditional septic systems are primarily designed to treat and dispose of wastewater, but they may not effectively remove nitrogen. The presence of excess nitrogen in wastewater can contribute to ecological and water pollution problems. ![Nitrogen-Reducing Septic System](/wp-content/uploads/2026/05/20220303_154752-res.jpg) In excess, nitrogen can cause oxygen depletion in water bodies, harmful algae blooms, and damage to aquatic ecosystems. Nitrogen-reducing septic systems are specifically designed to prevent this from happening by incorporating additional treatment processes to reduce nitrogen levels before treated wastewater is released into nearby bodies of water or the soil. If you want to put a nitrogen-reducing septic system on your property in **Florida**, we can help. At Southern Water and Soil, we are very familiar with this type of septic system and want to help you protect the environment around your property with one of these systems. We can provide you with more information about how these systems work, help you select the best possible nitrogen-reducing septic system for your property, and complete the installation from beginning to end. We have been working with septic systems for over 30 years, and we put this experience to work whenever we take on a new septic project. For more information about why you should consider putting a **nitrogen-reducing septic system** on your property or scheduling service with our team, [reach out to us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **nitrogen-reducing septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/), [Da](/nitrogen-reducing-septic-system-dade-city-fl/)[de](/nitrogen-reducing-septic-system-dade-city-fl/)[ City](/nitrogen-reducing-septic-system-dade-city-fl/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/), Land O’ Lakes, Lutz, Miami, [Odessa](/nitrogen-reducing-septic-system-odessa-fl/), [Orlando](/nitrogen-reducing-septic-system-orlando-fl/), Plant City, Wesley Chapel, [Spring Hill](/nitrogen-reducing-septic-system-spring-hill-fl/), and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/), [**Florida**](/nitrogen-reducing-septic-system-florida/).* ### Similar Services We Offer: --- ### [Nitrogen-Reducing Septic System, Tampa, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-tampa-fl/) **Published:** September 1, 2024 **Author:** Southern Water Soil **Content:** ## Consider the benefits of installing a nitrogen-reducing septic system. Here at Southern Water and Soil, we’re committed to helping property owners throughout the **Tampa, Florida** region with all their septic system needs. For over 30 years, our dedicated contractors have been offering comprehensive services for residential and commercial clients alike, and we’d be honored to give your property a more eco-friendly septic solution. ![Nitrogen-Reducing Septic System](/wp-content/uploads/2026/05/20220303_154752-res.jpg) A nitrogen-reducing septic system, also known as an ENR (Enhanced Nutrient-Reducing) system or an ENR-OSTDS (Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal System), helps prevent excess nitrogen from leaching into the local groundwater. With traditional septic systems, excessive amounts of nitrogen can build up, which can pose a range of environmental and health concerns. **Nitrogen-reducing septic systems** are specifically designed to capture nitrogen in wastewater and convert it into nitrogen gas instead. If you’re curious if a **nitrogen-reducing septic system** would be a good fit for your residential or commercial property, we encourage you to give us a call. One of our friendly team members will promptly set up an appointment with you to discuss your needs, assess your property, and determine the optimal solution for your unique home or business. You can count on us to offer a transparent quote, detailed plans, and plenty of information for you to review before you decide on your next steps. In a world that’s becoming increasingly aware of the impact that humans have on the environment, it’s important to take steps to reduce our carbon footprint and protect our local ecosystems. If you want to learn more about our services and how nitrogen-reducing septic systems work, please [contact us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we install **nitrogen-reducing septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/), Land O’ Lakes, Lutz, Miami, [Odessa](/nitrogen-reducing-septic-system-odessa-fl/), [Orlando](/nitrogen-reducing-septic-system-orlando-fl/), Plant City, Wesley Chapel, [Spring Hill](/nitrogen-reducing-septic-system-spring-hill-fl/), and [**Tampa**](/nitrogen-reducing-septic-system-tampa-fl/), [Florida](/nitrogen-reducing-septic-system-florida/).* ### Similar Services We Offer: --- ### [Nitrogen-Reducing Septic System, Spring Hill, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-spring-hill-fl/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## Using a nitrogen-reducing septic system helps preserve Florida’s beautiful wetlands. Most people are aware of the problems a malfunctioning septic system poses to people and animals—after all, it’s a well-known fact that exposure to sewage is a serious vector for disease. However, not as many people know about the risks septic systems pose to the environment. Many septic systems introduce high amounts of nitrogen into the groundwater, which leads to extreme algae growth in surrounding rivers, lakes, and other bodies of water. Our team at Southern Water and Soil has extensive experience in the septic industry, over 30 years’ worth, so we are well aware of these risks, and we do what we can to reduce them. For example, whenever possible, we use a **nitrogen-reducing septic system**, otherwise known as enhanced nutrient-reducing septic systems. ![Nitrogen-Reducing Septic System](/wp-content/uploads/2026/05/20220303_154752-res.jpg) The ecosystem here in Florida is full of aquatic life, including our iconic alligators, beloved manatees, and countless species of fish and birds. Our team can help you do your part to protect this precious biodiversity by installing a nitrogen-reducing septic system on your property. These systems are also called enhanced nutrient-reducing onsite sewage treatment and disposal systems (ENR-OSTDS) and help keep algae growth under control, so the local waters remain clean and healthy for all the plants and animals living there. We are proud to serve the community here in **Spring Hill, Florida**, and we want to do our part to protect the environment and prevent damage to the local ecosystem. If you are planning to build a new project or to replace an existing septic system, we encourage you to [give us a call](/contact-southern-water-and-soil/) to learn more about our ENR septic systems, also known as a **nitrogen-reducing septic system**. --- *At Southern Water and Soil, we install **nitrogen-reducing septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/), Land O’ Lakes, Lutz, Miami, [Odessa](/nitrogen-reducing-septic-system-odessa-fl/), [Orlando](/nitrogen-reducing-septic-system-orlando-fl/), Plant City, Wesley Chapel, [**Spring Hill**](/nitrogen-reducing-septic-system-spring-hill-fl/), and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/), [Florida](/nitrogen-reducing-septic-system-florida/).* --- ### [Nitrogen-Reducing Septic System, Orlando, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-orlando-fl/) **Published:** June 28, 2023 **Author:** Southern Water Soil **Content:** ## Consider a nitrogen-reducing septic system for your property. Traditional septic systems primarily focus on removing solid waste from wastewater, but they may not effectively remove nitrogen. In areas where nitrogen pollution is a concern, **nitrogen-reducing septic systems** — also known as Enhanced Nutrient-Reducing septic systems, Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal Systems (ENR-OSTDS), or ENR septic systems — can be used to mitigate the environmental impact of excess nitrogen in water sources. ![Nitrogen-Reducing Septic System](/wp-content/uploads/2026/05/20220303_154752-res.jpg) Nitrogen-reducing septic systems are designed to reduce the amount of nitrogen released into the environment. If not properly treated, nitrogen can contribute to water pollution, which can have damaging effects on water sources and water-based ecosystems. At Southern Water and Soil, we can help you install a nitrogen-reducing septic system on your property. We have installed these systems at many properties throughout the **Orlando, Florida** area, and we will provide excellent customer service and even better workmanship. There are many different types of nitrogen-reducing septic systems available, and not every option will be the best possible choice for your property. We will help you peruse your options and choose a nitrogen-reducing septic system that aligns with local regulations and will work well for wastewater disposal on your particular property. We can also answer any questions you might have about nitrogen-reducing septic systems and how this particular type of septic system works. We have been working with septic systems for many years now, and we are your source for reliable advice and exceptional septic services. For more information about **nitrogen-reducing septic systems** or to schedule a consultation with our professionals, [contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **nitrogen-reducing septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/), [Dad](/nitrogen-reducing-septic-system-dade-city-fl/)[e](/nitrogen-reducing-septic-system-dade-city-fl/)[ City](/nitrogen-reducing-septic-system-dade-city-fl/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/), Land O’ Lakes, Lutz, Miami, [Odessa](/nitrogen-reducing-septic-system-odessa-fl/), [**Orlando**](/nitrogen-reducing-septic-system-orlando-fl/), Plant City, Wesley Chapel, [Spring Hill](/nitrogen-reducing-septic-system-spring-hill-fl/), and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/), [Florida](/nitrogen-reducing-septic-system-florida/).* --- ### [Nitrogen-Reducing Septic System, Odessa, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-odessa-fl/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## A nitrogen-reducing septic system may be the best option for your property. Traditional septic systems work pretty well in most places, but there are reasons that they might not be the best option for your residential or commercial property in **Odessa, Florida** or the surrounding area. One of the potential issues with a traditional septic system is the accumulation of excess nitrogen. Now, nitrogen gas occurs naturally in our atmosphere in large amounts, but in the ground and groundwater, it can lead to algae growth, harming aquatic life and potentially degrading the water quality. ![Nitrogen-Reducing Septic System](/wp-content/uploads/2026/05/20220303_154752-res.jpg) If you are interested in avoiding these potential problems and participating in a more sustainable, environmentally friendly practice, a **nitrogen-reducing septic system** may be the best option for your property. These systems are called by several names, including enhanced nutrient-reducing septic systems, enhanced nutrient-reducing onsite sewage treatment and disposal systems (ENR-OSTDS), and ENR septic systems. Whatever you call it, the basic idea is that the system contains components that help convert nitrogen into nitrogen gas, which can then be released into the atmosphere, reducing the amount of nitrogen that ends up in the ground and groundwater. A nitrogen-reducing septic system can be a great choice for all types of property owners. Whether your property is residential, commercial, or industrial, this type of system adds real value to the property and helps you avoid the problems that can be associated with a traditional septic system. If you have an existing septic system in place, we may be able to help upgrade it to a **nitrogen-reducing septic system** as well. [Contact us](/contact-southern-water-and-soil/) today at Southern Water and Soil with any questions you have or to schedule an appointment. --- *At Southern Water and Soil, we install **nitrogen-reducing septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/), Land O’ Lakes, Lutz, Miami, [**Odessa**](/nitrogen-reducing-septic-system-odessa-fl/), [Orlando](/nitrogen-reducing-septic-system-orlando-fl/), Plant City, Wesley Chapel, [Spring Hill](/nitrogen-reducing-septic-system-spring-hill-fl/), and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/), [Florida](/nitrogen-reducing-septic-system-florida/).* --- ### [Nitrogen-Reducing Septic System, Brooksville, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-brooksville-fl/) **Published:** November 2, 2023 **Author:** Southern Water Soil **Content:** ## Invest in a nitrogen-reducing septic system to reduce the risk of environmental damage. As we have become more aware of the effects of different practices on the environment, many people are striving to reduce their impact and protect the world around them. However, one thing that is often overlooked in conversations around environmental protection is the potential risks associated with septic systems. Of course, septic systems are essential for many commercial and residential properties, but the groundwater that moves through these systems may accumulate excess nitrogen, which can create problems. ![Nitrogen-Reducing Septic System](/wp-content/uploads/2026/05/20220303_154752-res.jpg) Nitrogen makes up roughly 75% of our atmosphere and is highly prevalent throughout the world. It’s found in proteins and minerals, and the gas is colorless and odorless. The presence of nitrogen isn’t harmful on its own, but when it occurs in higher quantities in the wastewater of a septic system, it can cause an overgrowth of algae. Excessive algae in the water can degrade its quality and threaten aquatic life, so our team is committed to finding a better solution. At Southern Water and Soil, we can prevent common issues with old septic systems by offering a **nitrogen-reducing septic system** instead. We work with property owners located throughout the **Brooksville, Florida** area to design and install nitrogen-reducing septic system solutions that accommodate their needs. By investing in a **nitrogen-reducing septic system**, you can reduce the risk of environmental damage while protecting the water used on your property. We can upgrade existing systems with components that reduce nitrogen levels as well, so don’t hesitate to [contact us](/contact-southern-water-and-soil/) today to learn more. --- *At Southern Water and Soil, we install **nitrogen-reducing septic systems** in [**Brooksville**](/nitrogen-reducing-septic-system-brooksville-fl/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/), Land O’ Lakes, Lutz, Miami, [Odessa](/nitrogen-reducing-septic-system-odessa-fl/), [Orlando](/nitrogen-reducing-septic-system-orlando-fl/), Plant City, Wesley Chapel, [Spring Hill](/nitrogen-reducing-septic-system-spring-hill-fl/), and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/), [Florida](/nitrogen-reducing-septic-system-florida/).* ### Similar Services We Offer: --- ### [Nitrogen-Reducing Septic System, Dade City, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-dade-city-fl/) **Published:** May 29, 2023 **Author:** Southern Water Soil **Content:** ## Avoid potential issues associated with traditional septic systems. The importance of sustainable practices in every aspect of our lives is becoming increasingly apparent. These practices include how we manage wastewater. While effective in many ways, traditional septic systems can contribute to the accumulation of excess nitrogen in groundwater. At Southern Water and Soil in **Dade City, Florida**, we are committed to providing innovative and environmentally friendly solutions to this problem with **nitrogen-reducing septic systems,** also known as Enhanced Nutrient-Reducing septic systems, Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal Systems (ENR-OSTDS), or ENR septic systems. ![Nitrogen-Reducing Septic System](/wp-content/uploads/2026/05/20220303_154752-res.jpg) Nitrogen in wastewater can cause the overgrowth of algae, which can endanger aquatic life and degrade water quality. **Nitrogen-reducing septic systems** are advanced systems that incorporate a special process that transforms the nitrogen in wastewater into nitrogen gas, which is harmless and makes up a sizable portion of our atmosphere. This process, called denitrification, significantly reduces the environmental impact of wastewater and helps maintain our water bodies’ health. We are experts in designing, installing, and maintaining nitrogen-reducing septic systems. Investing in a nitrogen-reducing septic system contributes to the environment’s health and adds value to your property. It can help you avoid potential issues associated with traditional systems, such as the contamination of well water, and it can be a strong selling point if you ever decide to sell your property. So, if you want to install a new septic system or upgrade your existing one, consider a nitrogen-reducing septic system. We can provide you with a system that’s designed correctly, cost-effective, and installed with minimal disruption. [Contact us today to learn more](/contact-southern-water-and-soil/) about our services and how we can help you achieve your wastewater management goals. We look forward to working with you. --- *At Southern Water and Soil, we install **nitrogen-reducing septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/), **[Dade City](/nitrogen-reducing-septic-system-dade-city-fl/)**, [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/), Land O’ Lakes, Lutz, Miami, [Odessa](/nitrogen-reducing-septic-system-odessa-fl/), [Orlando](/nitrogen-reducing-septic-system-orlando-fl/), Plant City, Wesley Chapel, [Spring Hill](/nitrogen-reducing-septic-system-spring-hill-fl/), and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/), [Florida](/nitrogen-reducing-septic-system-florida/).* ### Similar Services We Offer: --- ### [Septic Inspections, Tampa, FL](https://southernsepticanddesign.com/septic-inspections-tampa-fl/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## Not sure what’s up with your septic system? Give us a call. With age, septic systems naturally get worn down or damaged due to their constant use and placement in the ground. **Septic inspections** are, therefore, a key part of septic maintenance to scope out your system and make note of any problem areas or potential issues that can affect your system. It’s hard to tell what your septic system is dealing with if you don’t have it inspected from time to time, which is why we offer septic inspections as one of our many services here at Southern Water and Soil. ![Septic Inspections](/wp-content/uploads/2026/05/IMAG1003-res.jpg) The importance of having your system checked out by a professional from time to time can’t be overstated. Identifying hidden issues before they get worse helps you avoid the dangers that come with full-blown septic disasters. By diagnosing problems while they’re small, you can address these problems before they get the chance to get worse and cause further damages that aren’t as easy to repair. If you’re in the **Tampa, Florida** area, we would be glad to perform an inspection on your septic system. Our **septic inspections** are thorough and reliable at finding hidden issues that you may not have noticed until they’ve wreaked havoc. Like with any other service necessary on your property, it’s important to find the right team for the job, and you won’t find a better septic inspection team than us. We’ve got years of experience working with septic systems and know what to look for in a faulty or damaged one, so don’t hesitate to [reach out to us](/contact-southern-water-and-soil/) today to make sure your system is in good shape. --- *At Southern Water and Soil, we perform **septic inspections** in [Brooksville](/septic-inspections-brooksville-fl/), [Dade City](/septic-inspections-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-inspections-odessa-fl/), Orlando, Plant City, [Spring Hill](/septic-inspections-spring-hill-fl/), and [**Tampa**](/septic-inspections-tampa-fl/), Florida.* ### Similar Services We Offer: --- ### [Septic Inspections, Spring Hill, FL](https://southernsepticanddesign.com/septic-inspections-spring-hill-fl/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## Schedule a professional septic inspection so that you can invest with confidence. When you’re thinking about purchasing a new house or investing in a new commercial property, it’s crucial to take a closer look at the building from top to bottom. While scheduling a home or property inspection is a great start, our team at Southern Water and Soil highly recommends **septic inspections** to anyone buying a property with a septic system. Taking this simple precaution can be an easy way to avoid nasty sewage backups and other unpleasant surprises in the future. ![Septic Inspections](/wp-content/uploads/2026/05/IMAG1003-res.jpg) Our team has been providing professional septic inspections for residential, commercial, and industrial clients throughout the **Spring Hill, Florida** area for over 30 years, and we would be honored to assist you. You can count on us to be efficient, professional, and thorough to give you the peace of mind you need, whether you’d like a routine septic inspection or an inspection before investing in a new property. Due to our decades of industry experience, we know exactly what to look for during septic inspections, and we’ll be sure to clearly convey the necessary information to you once the job is finished. During a standard septic inspection, we will check the crucial components of the system, including the septic tank and drain field, to ensure everything is functioning properly. We’ll carefully examine the system for any signs of damage or tree root intrusion and alert you of any potential problems you might experience in the future. Prospective home and property buyers can trust us for comprehensive **septic inspections** that will give them the confidence and information they need to make the right real estate decision. Before you agree to buy a piece of land in the Spring Hill area, [give us a call](/contact-southern-water-and-soil/) for a septic inspection first. We look forward to assisting you! --- *At Southern Water and Soil, we perform **septic inspections** in [Brooksville](/septic-inspections-brooksville-fl/), [Dade City](/septic-inspections-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-inspections-odessa-fl/), Orlando, Plant City, **[Spring Hill](/septic-inspections-spring-hill-fl/)**, and [Tampa](/septic-inspections-tampa-fl/), Florida.* ### Similar Services We Offer: --- ### [Septic Inspections, Odessa, FL](https://southernsepticanddesign.com/septic-inspections-odessa-fl/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## Feel confident in the condition of your septic system after our septic inspection is complete. At Southern Water and Soil, we are passionate about delivering the best and most cost-effective septic solutions to all types of property owners in **Odessa, Florida** and the surrounding area. We know that one of the best ways to protect your property and to get valuable knowledge about the condition of your septic system is to invest in periodic **septic inspections**. This is especially important when you are considering buying or selling property, whether it is residential, commercial, industrial, or another type of real estate. ![Septic Inspections](/wp-content/uploads/2026/05/IMAG1003-res.jpg) When you call us about septic inspections, here is what you can expect: - We will come to your property in a timely fashion and locate your septic system if you are unsure of its location. - We will conduct a complete and thorough inspection of the septic tank and other components, including the drain field and anything else that makes up your system. - We will assess the system for signs of tank issues and possible drain field problems. - Once we complete our inspection and assessment, we will report back to you. How is the system working now? What problems might we expect in the future? And how long will your system likely last before replacement is necessary? These are some questions we aim to answer. With our more than three decades of experience, we hope to help you feel confident in the condition of your septic system after our septic inspection is complete. [Give us a call](/contact-southern-water-and-soil/) today to learn more about our **septic inspections** or schedule an appointment. --- *At Southern Water and Soil, we perform **septic inspections** in [Brooksville](/septic-inspections-brooksville-fl/), [Dade City](/septic-inspections-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [**Odessa**](/septic-inspections-odessa-fl/), Orlando, Plant City, [Spring Hill](/septic-inspections-spring-hill-fl/), and [Tampa](/septic-inspections-tampa-fl/), Florida.* --- ### [Septic Inspections, Brooksville, FL](https://southernsepticanddesign.com/septic-inspections-brooksville-fl/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## Septic inspections are an important part of the buying and selling process. Are you considering buying or selling a property in **Brooksville, Florida** or nearby? Most people are aware that a property must be inspected before a real estate transaction can occur, but **septic inspections** are a little different and are not usually included in the regular, required inspection. At Southern Water and Soil, we believe that septic inspections are an important part of the buying and selling process, and we encourage you to schedule one right away. ![Septic Inspections](/wp-content/uploads/2026/05/IMAG1003-res.jpg) You may be wondering how septic inspections are different. Here are a few things to know: - Septic inspections focus specifically on the septic system, including the plumbing coming from your building that feeds the septic system, the septic tank, the drain field, and any other components, depending on the type of system you have. - Septic inspections will give you valuable information about the condition and history of the current septic system. You will know if the system has been properly maintained, how it is operating currently, and what to expect in the future as far as its lifespan and needed repairs. - **Septic inspections** are important for all types of property. Simple residential septic systems, more complex commercial systems, and others all need inspections. Don’t leave the future up to chance. Before you sign on any dotted lines, know what you are getting into. Once your inspection is complete, you can rely on us for any repairs, maintenance, or other work that may be needed to get the system performing optimally. [Contact us](/contact-southern-water-and-soil/) now to schedule your septic inspection or to ask any questions you may have. --- *At Southern Water and Soil, we perform **septic inspections** in [**Brooksville**](/septic-inspections-brooksville-fl/), [Dade City](/septic-inspections-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-inspections-odessa-fl/), Orlando, Plant City, [Spring Hill](/septic-inspections-spring-hill-fl/), and [Tampa](/septic-inspections-tampa-fl/), Florida.* ### Similar Services We Offer: --- ### [Commercial Septic, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Excerpt:** Our commercial septic experts at Southern Water & Soil can install or replace a grease trap in your existing system, or we can install an entirely new commercial septic system for your restaurant, office, mobile home parks, RV Parks, strip centers, or schools, in Tampa, FL. **Content:** ## Our experts can install or replace a grease trap in your existing system, or we can install an entirely new commercial septic system for your restaurant or office in Tampa, FL. If you have a septic system on your commercial property, you may not know the importance of having a functioning grease trap. This is particularly crucial in restaurants and other commercial buildings that produce food products. When you or your employees drain the sink, this water has small oil particles that become part of the scum layer in the **commercial septic** tank. Every time you cook something, the grease or oil will typically go down the drain, as well. If this scum layer becomes too thick because of the grease, this can cause a blockage in the pipes, which can ultimately damage the environment. Since restaurants use more oil, there is more in the wastewater, so septic systems in these buildings often back up more often. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) The grease trap is between the sink and septic tank, where it catches and traps grease before it can go into the tank. You can choose from **commercial septic** grease traps that have higher capacity, which will require less frequent cleaning. Grease traps are usually constructed from durable stainless steel, plastic, concrete, or cast iron, and we can help determine the best type of grease trap for your business. You can prevent clogs and other problems in your septic tank by having our experts clean out your grease trap regularly. Our commercial septic experts at Southern Water & Soil can install or replace a grease trap in your existing system, or we can install an entirely new commercial septic system for your restaurant or office, including low-pressure dosing systems. Our service area includes Tampa, Florida, and many of the surrounding cities. #### Ready to get started? [Fill out a Job Requisition](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), [Miami](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/), and **[Tampa](/commercial-septic-tampa-fl/)**, [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## Allow us to take care of your commercial septic system. Owning or managing a business comes with a whole host of responsibilities, so it can be easy for some details and tasks to fall by the wayside once in a while. One crucial aspect that many business owners in the **Spring Hill, Florida** area tend to overlook is their commercial septic systems. If your facility relies on a commercial septic system, our team would be more than happy to help you keep it in good working order. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) At Southern Water and Soil, our team is proud to serve residential, commercial, and industrial clients with their septic needs. We have been in this industry for over 30 years, and we strive to put our knowledge and expertise to good use on every job we tackle. You can always count on us for all your **commercial septic** needs and the clear, honest information you deserve to know to keep your system in great condition. Our team can handle commercial septic jobs of all shapes and sizes, whether you have a small retail store or a large industrial facility. We can efficiently and meticulously provide you with septic inspection services, repairs, maintenance, replacements, and more. We specialize in designing and engineering commercial septic systems, so you can also rely on us to create a custom septic design that’s best suited for your property and your business’s unique needs. When it comes to something as crucial as your **commercial septic** system, you shouldn’t just put your trust in the first company you come across. Instead, we encourage you to reach out to a local business that will keep your best interests in mind and provide you with the exceptional services you deserve. Simply give us a call today to learn more about our commercial septic services or [schedule an appointment](/contact-southern-water-and-soil/)! --- *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), [Miami](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/)**, and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Plant City, FL](https://southernsepticanddesign.com/commercial-septic-plant-city-fl/) **Published:** May 27, 2019 **Author:** Southern Water Soil **Content:** ## Don’t rely on just anyone with something as important as your commercial septic system. If you need service for your **commercial septic** system, you probably have a lot more riding on it being done right than you would with the system at your home. With that said, it makes sense to trust a company that has a solid reputation for handling the complexities of a commercial septic system and is equipped and experienced to do everything from grease trap maintenance to installing a new system. Turning to us at Southern Water and Soil is a wise decision, as we offer septic solutions that are designed properly, cost-effective, and provided in a professional manner from start to finish. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) We offer a wide range of **commercial septic** services in the Plant City, Florida area, including system design, maintenance, septic tank repair, aerobic septic systems, drain field options, installations for new construction, and replacement septic tanks and drain fields. We can engineer a performance-based septic system that will give you many years of reliable service. We also offer commercial septic inspections, so if you want peace of mind that your current property’s septic system is functioning properly or you are purchasing a new property and want an inspection as part of your due diligence process, give us a call. Our highly cross-trained team is ready to exceed your expectations for any commercial septic service your office, retail business, restaurant, or other type of business requires. If you have any questions about our commercial septic services or would like to discuss a maintenance plan or a new project, don’t hesitate to [contact us](/contact-southern-water-and-soil/). #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/),[ Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), [Miami](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, **[Plant City](/commercial-septic-plant-city-fl/)**, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/), and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/) **Published:** July 25, 2015 **Author:** Southern Water Soil **Content:** ## The nature of the soil at the site, the slope, and the water table all come into play when dealing with any type of commercial septic system in Odessa, FL. Commercial septic services can be much more complex when compared to their residential counterparts, but the design and implementation of a commercial septic system uses much of the same math. The key to determining the size and composition of any **commercial septic** installation is usage. By determining the average number of gallons of waste water a given commercial property will produce during a given period of time, the proper tank size, tank type, and drain field can be determined to provide the right capacity to the commercial property. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) Once the desired and needed capacity is determined, deciding on the proper site, structure, and location of the various components of a commercial septic system will transfer easily to the permit process. The specific type of zoning of the commercial area can also determine what is and is not permissible in commercial septic applications, so it’s wise to work with someone who knows the locally applicable rules and regulations as you prepare the permit to ensure that the work can be done on time. Depending on the commercial site, the industry involved can also affect the amount of waste water generated and, in turn, the size and complexity of the septic system. The nature of the soil at the site, the slope, and the water table all come into play when dealing with any type of **commercial septic** system. At Southern Water and Soil, we have years of experience in commercial septic design, implementation, and services in Odessa, Florida. Our focus has always been to improve the quality and quantity of available water in the area. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), [Miami](/commercial-septic-miami-fl/), **[Odessa](/commercial-septic-odessa-fl/)**, Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/), and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Miami, FL](https://southernsepticanddesign.com/commercial-septic-miami-fl/) **Published:** April 11, 2023 **Author:** Southern Water Soil **Excerpt:** Our commercial septic experts at Southern Water & Soil can install or replace a grease trap in your existing system, or we can install an entirely new commercial septic system for your restaurant, office, mobile home parks, RV Parks, strip centers, or schools, in Tampa, FL. **Content:** ## We are your source for high-quality commercial septic services. Here in the **Miami, Florida** area, many commercial properties rely on a **commercial septic** system to keep their wastewater disposal system running properly. If your commercial property uses a septic system, you need a reliable septic contractor on your side who can help with your septic system whenever something comes up. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) Our highly experienced team here at Southern Water and Soil specializes in providing commercial septic services to businesses in the Miami area. Some of the commercial septic services we offer include: - **Commercial septic tank installation—**You can rely on us to install your new septic tank and ensure it works properly following the installation process. - **Commercial septic system design—**We can design a new septic system particularly for your commercial location, ensuring that it meets all necessary local guidelines. - **Commercial septic system engineering—**We can engineer a new septic system for your commercial site and design it to meet your specific requirements. - **Commercial septic system repair—**If something ever goes wrong with your commercial septic system, call us for help rectifying the issue. We can also provide ongoing maintenance to ensure that we can catch any potential problems before they get worse. Why should you choose us as your **commercial septic** contractor? Not only are we experienced, but we have the necessary skills to properly service, design, and install commercial septic systems of all types and sizes. [Contact us](/contact-southern-water-and-soil/) today to learn more and to find out more about the different septic services we offer. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), [**Miami**](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill,](/commercial-septic-spring-hill-fl/) and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/) **Published:** January 20, 2016 **Author:** Southern Water Soil **Content:** ## You can count on us to provide the most thorough commercial septic services in Lutz, FL. Unless your Lutz, FL business is conveniently located near a waste processing facility, chances are good that you have a septic system on your property. Most septic systems consist of two primary components—a septic tank where initial waste processing takes place and a drain field where second-stage filtration occurs before the water is released back into the environment. Making sure that both of these components keep working properly will require routine commercial septic maintenance and repair. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) When it comes to **commercial septic** system maintenance, pumping your septic tank every three to five years is incredibly important. It is also a good idea to have your septic pipes cleaned once in a while to prevent sewage backup into your yard. An occasional septic inspection is also recommended to find and repair minor issues before they have a chance to become major problems. You may be tempted to perform basic commercial septic repairs or maintenance tasks yourself, but it is not a good idea. Unless you have a lot of experience working with septic systems, you could actually end up doing more harm than good. It is well worth the cost to hire a professional to make sure the job gets done right. If you find yourself in need of commercial septic services in Lutz, FL, then Southern Water and Soil is the name to know. We are experts in the septic industry, so you can count on us to provide for all of your septic needs. We offer not only **commercial septic** tank pumping and repair services, but also drain field maintenance, septic inspections, and even emergency 24-hour service. What more could you ask for? #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), **[Lutz](/commercial-septic-lutz-fl/)**, [Miami](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/), and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/) **Published:** June 7, 2016 **Author:** Southern Water Soil **Content:** ## We have the wastewater and commercial septic solutions you need in Land O’ Lakes. When you look for a **commercial septic** company, how do you know you have found the right one? Price? Experience? Reputation? At Southern Water and Soil, we can meet all of these expectations and more for your Land O’ Lakes, Florida community. We are here to prove to you that when you choose our highly qualified team at Southern Water and Soil, you will feel confident that you made the right choice. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) With over 30 years of combined experience in the wastewater industry, our team at Southern Water and Soil is dedicated to exceeding customer expectations and providing point-of-origin solutions to water quality and quantity challenges. This means that many of our technicians didn’t just learn the trade, but know the ins and outs of the commercial septic business. Many commercial septic companies are out there, but we continue to prove year after year that we are your top choice by setting ourselves apart when it comes to price, experience, and customer satisfaction. When you call us at Southern Water and Soil, you can rest assured that we can handle any problem, maintenance or repairs that you might need. We offer a wide variety of services, including septic tanks, septic pumping, grease trap installation and maintenance, drain field services, sewer backups and much more. We can repair, install, clean or maintain almost any part of your community’s septic system in order to keep your system running its best. At Southern Water and Soil, we have the wastewater and **commercial septic** solutions you need. [Contact us](/contact-southern-water-and-soil/) today! #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), **[Land O’ Lakes](/commercial-septic-land-o-lakes-fl/)**, [Lutz](/commercial-septic-lutz-fl/), [Miami](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/), and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Fort Myers, FL](https://southernsepticanddesign.com/commercial-septic-fort-myers-fl/) **Published:** July 11, 2016 **Author:** Southern Water Soil **Content:** ## With over 30 years of experience engineering commercial septic systems, we are confident that your project in Fort Myers will benefit from our expertise. Since both residential and commercial properties vary so much in terms of their construction, size, wastewater collection needs, and many other factors, it doesn’t make sense for wastewater systems to come standard. At Southern Water and Soil, we understand this, which is why we specialize in **commercial septic** engineering. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) We are unlike other septic companies in the Fort Myers, Florida area because we focus on designing unique septic systems and installing them with complete precision. Some of the more specialized commercial systems we work with include package plants, effluent sewers, and cluster wastewater treatment systems. During the design phase of commercial septic systems, we only use materials and products from manufacturers we know and trust. For instance, many of our commercial systems include materials from Norweco and Orenco. By doing this, we ensure the functionality and efficiency of your commercial location’s wastewater treatment system for years to come. With over 30 years of experience engineering **commercial septic** systems, we guarantee your project will benefit from our expertise. In addition to our experience, our commitment to customer satisfaction is second-to-none, and we ensure all of our projects surpass our clients’ expectations for value. We would be more than happy to answer any questions you might have about our design and engineering services for commercial locations. Schedule your consultation today by [giving us a call](/contact-southern-water-and-soil/) at Southern Water and Soil. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer commercial septic services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), **[Fort Myers](/commercial-septic-fort-myers-fl/)**, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), Miami, [Odessa](/commercial-septic-odessa-fl/), [Orlando](/commercial-septic-orlando-fl/), [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/), and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Florida](https://southernsepticanddesign.com/commercial-septic-florida/) **Published:** June 27, 2023 **Author:** Southern Water Soil **Content:** ## Choose us for commercial septic solutions. From paying your employees, implementing techniques for improved operational success, and ordering inventory, everything you do as a business owner is done on a larger scale. The **commercial septic** system your location or facility uses is no different, and on a daily basis, it likely serves a large number of people. This is why you should partner with a company with a longstanding reputation for success here in **Florida**. ![Commercial Septic](https://b593516.assetcdn.net/593516/wp-content/uploads/2026/05/20130825_163335-res.jpg?lossy=1&strip=0&webp=1) At Southern Water and Soil, we are a commercial septic company known for our expertly engineered solutions. If you need help engineering a commercial septic system for your site, we are the company to turn to. We have years of experience working on commercial septic systems, and we always put our customers and their needs first. One of the biggest things that set us apart is that we stay up to date on the newest technologies and developments happening in the septic industry. This allows us to continually provide business owners with the best of the best in terms of results and service. Whether you need routine maintenance done on your system or you want a new system engineered for a building under construction, we will provide the expertise and experience you need and want. For all of your company’s **commercial septic** needs, we are here to exceed your expectations. To learn more about how we approach new commercial septic projects and why you should hire us, [reach out to us today](/contact-southern-water-and-soil/). #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) ### FAQs About Commercial Septic Services We are proud to provide a variety of commercial septic services to businesses throughout Florida and have answered some frequently asked questions below for your information. Contact us if you have any other questions. ##### Hidden ##### Can you assist with permitting and inspections? Yes! We are Certified Master Septic Contractors who are licensed to provide permitting before work begins and carry out inspections once [septic systems](/residential-septic-services-dade-city-fl/septic-systems/) are completed for both commercial and residential systems. ##### Does my commercial septic system need to be updated under the new BMAP rules? Some specific properties are required to be updated to pass inspection or must convert to a sewer system. If this applies to your property, we can offer the insights you need after reviewing your situation. If your property has been identified as one of the properties needing updates, we can explain your options and handle the design and engineering. ##### What is a septic to sewer conversion? Under the new BMAP rules, specific regions in Florida need to switch from septic systems to managed sewer systems. This change attempts to combat septic systems’ contamination of groundwater, fresh water, and the ocean due to nitrogen. Septic to sewer conversions also help with reducing the risk of individual septic system failures. ### Contact Southern Water and Soil Today! [Contact Us](#) *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), [Miami](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill](/septic-inspections-spring-hill-fl/), and [Tampa](/commercial-septic-tampa-fl/), [**Florida**](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Brooksville, FL](https://southernsepticanddesign.com/commercial-septic-brooksville-fl/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## We can help you keep your commercial septic system in the best condition. Managing a commercial property involves a variety of obligations, one of which is to maintain a functional septic system. A well-operating **commercial septic** system is essential for the efficient operation of any business, whether it’s a restaurant, hotel, or industrial complex. With this in mind, it’s important to work with a dependable commercial septic partner, such as our team at Southern Water and Soil. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) While it might not seem like it, septic systems are complex, and their upkeep necessitates specialized expertise and experience. With more than 30 years in the commercial septic industry, we bring a lot of experience to the table, ensuring that every job meets the highest standards. You’ll also find that we’re able to accurately diagnose problems and implement effective remedies, giving you confidence that your system is in capable hands. Commercial septic systems must follow certain municipal, state, and federal laws. Noncompliance might lead to significant fines and legal issues. By understanding this, we can help you maintain your system to meet all standards. This compliance not only avoids penalties but also improves the overall safety and cleanliness of your facility. In business, every dollar counts, which is why you might be tempted to take shortcuts with commercial septic care. However, doing so can result in larger bills in the long run. Instead, you can trust our team to offer affordable solutions with an emphasis on long-term savings. In the end, investing in quality maintenance and repairs can help you avoid the increased costs associated with emergency services and system breakdowns. If you need assistance with your **commercial septic** system in **Brooksville, Florida** and the surrounding area, [contact our team](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we offer **commercial septic** services in [**Brooksville**](/commercial-septic-brooksville-fl/), [Dade City](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), [Miami](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/), and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/) **Published:** October 31, 2018 **Author:** Southern Water Soil **Content:** ## We are the commercial septic partner you’ve been looking for. As a business owner, you do everything on a large scale, from ordering inventory and paying employees to implementing initiatives for greater operational success. Your **commercial septic** system is no different, and it likely serves a large number of people on a day-to-day, long-term basis. This is why your commercial septic system deserves the knowledge and expertise of a company with a longstanding reputation for success here in the Dade City, Florida area – Southern Water and Soil. ![Commercial Septic](/wp-content/uploads/2026/05/20130825_163335-res.jpg) Servicing commercial septic systems, although a large part of what we do, is only partially what we offer businesses in Dade City. Since your facilities and operations are unique, we can help you custom design, engineer, and install a large-scale septic system that lends itself to high volumes of wastewater and heavy use on an ongoing basis. We stay up to date on the newest developments and technology in the septic industry, which allows us to provide business owners with the best of the best in terms of service and results. Whether you require routine maintenance and pumping to ensure the operations of your septic system or you want to engineer a new system for a building undergoing construction, our team is the only one you need. We would be happy to tell you more about the many **commercial septic** services we offer and our impressive capabilities. For additional information or to schedule service, [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today. We are eager to hear from you and to partner with your business! #### Ready to get started? [Fill out a Job Requisition](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic** services in [Brooksville](/commercial-septic-brooksville-fl/), [**Dade City**](/commercial-septic-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), [Miami](/commercial-septic-miami-fl/), [Odessa](/commercial-septic-odessa-fl/), Orlando, [Plant City](/commercial-septic-plant-city-fl/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/), and [Tampa](/commercial-septic-tampa-fl/), [Florida](/commercial-septic-florida/).* ### Similar Services We Offer: --- ### [Commercial Septic Company, Orlando, FL](https://southernsepticanddesign.com/commercial-septic-orlando-fl/commercial-septic-company/) **Published:** September 20, 2017 **Author:** Southern Water Soil **Content:** ## As your commercial septic company, we can help you achieve the best performance from this important system in Orlando. ![Commercial Septic Company in Orlando, Florida](/wp-content/uploads/2017/09/commercial-septic-company-300x188.jpg) When you own a business with a septic system, it is important that your wastewater management system is trustworthy and reliable. At Southern Water and Soil, we believe the best way to maintain your septic system is by having a commercial septic company that also embodies these traits. Not only do we offer comprehensive commercial septic services to meet your needs in Orlando, Florida, but you will also find our experienced team equipped to address all your septic concerns from business acquisition to new installation and ongoing servicing. Our team at Southern Water and Soil has over 30 years of experience providing solutions for commercial businesses that operate septic systems in the Orlando area. As your **commercial septic company** of choice, we know all the ins-and-outs of your commercial septic system and can help you achieve the best performance. From the initial permitting required to break ground on a new business location to the initial septic design required for your commercial business and completed installation, our team can handle the job from start to finish. We can also make expert recommendations for the maintenance that will keep your septic investment working well year after year. At Southern Water and Soil, we believe that your **commercial septic company** should provide every possible avenue for the success of your septic system and your business, and we aim to do just that. If you have questions about our services or are looking for a commercial septic company to assist with your business’ wastewater management system in Orlando, contact us today. --- *At Southern Water and Soil, our **commercial septic company** proudly serves Brooksville, [Dade City](/commercial-septic-brandon/commercial-septic-company/), Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), **[Orlando](/commercial-septic-orlando-fl/commercial-septic-company/)**, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), Florida.* --- ### [Commercial Septic Company, Florida](https://southernsepticanddesign.com/commercial-septic-florida/commercial-septic-company/) **Published:** March 20, 2024 **Author:** Southern Water Soil **Content:** ## We design and install innovative, efficient septic systems. Does your **Florida** business need a new septic system installed or the existing one repaired? As a commercial property owner, you know a failing septic leads to expensive headaches down the road. Avoid nuisance violations and downtime by turning to us at Southern Water and Soil. For over 30 years, we’ve been a **commercial septic company** providing innovative, efficient septic systems for commercial spaces. Our full-service approach handles everything from initial consultations to permitting, installation, and repairs. No matter the industry – restaurants, hotels, office buildings, you name it – we’ve got the experience to customize septic systems to meet drain field demands while respecting environmental regulations. ![Commercial Septic Company in Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/06/2012-11-21-10.29.41-res.jpg?lossy=1&strip=0&webp=1) Our specialized commercial team surveys your property and builds a robust septic blueprint using the latest technology to identify optimizations. We’ll also handle all the paperwork and agency approvals from start to finish. As a **commercial septic company**, we understand the importance of a project coming in on budget and on time, so our crew brings precision and care to every commercial project, working around your schedule and constraints. We adhere to requirements from the Florida Department of Health and the Florida Department of Environmental Protection, so the system we design for you meets all regulations and will qualify for a local permit. Our president, Greg Mayfield, has worked for the Southwest Florida Water Management District and the Florida Department of Health. When choosing a commercial septic company, it should know your industry’s pain points in waste disposal. For example, restaurants and commercial kitchens require specialized traps to capture fats, oils, and solids before entering sewer lines. We handle compliant installation and engineering of those systems. We also design nutrient-reducing systems that use the latest filtration methods. These systems preserve environmental integrity in areas with stringent drainage standards. Don’t leave waste management to chance – connect with our experts today for affordable septic solutions that put your commercial property first. [Contact us](/contact-southern-water-and-soil/) to schedule a consultation. ### Contact Southern Water and Soil Today! [Contact Us](#) ### FAQs About Our Commercial Septic Company As your commercial septic company, we are dedicated to addressing your specific septic needs, relying on our three decades of experience and extensive knowledge of the septic industry to bring you the best services. We know better than most how important it is to hire a reliable and professional commercial septic company, and we are here to assure you that our team can deliver what you need. Check out our frequently asked questions below and contact us to learn more. ##### Hidden ##### Do you offer low nitrogen septic system engineering? Yes, low nitrogen [septic system engineering](/commercial-septic-florida/commercial-septic-system-engineering/) is one of our areas of specialty. We can explain the system requirements for your commercial property, as well as the options available to you. We can engineer the system while our sister company, Southern Water Distribution, can deliver all the parts and pieces that are needed to complete the work. ##### Can you provide inspections? We are Certified Master Septic Contractors. Licensed by the state of Florida, we are able to provide inspections for your commercial septic system. ##### Do you do permits? Yes. We are familiar with the regulations that must be followed and can assist with obtaining the permits your system requires. ##### Does my septic system need to be updated? This depends on the age of the system that you’re replacing. Given BMAP (Basin Management Action Plan) regulations, some properties are required to update their septic system or convert to a public sewer system in an effort to reduce nitrogen contamination of either groundwater, fresh water, or the ocean. We can help you understand what rules apply to you and what your options are for meeting them. ### Contact Southern Water and Soil Today! [Contact Us](#) *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), **[Florida](/commercial-septic-florida/commercial-septic-company/)**.* --- ### [Distributed Wastewater Treatment Systems, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/) **Published:** March 23, 2026 **Author:** Southern Water Soil **Content:** ## Distributed wastewater treatment systems are comparable to what most municipal plants use, but on a smaller scale. Wastewater treatment doesn’t look the same from one project to another. It takes significant experience and attention to innovations in the industry to be able to come up with reliable solutions. At Southern Water and Soil, we have over three decades of experience performing package plant installations in the **Odessa, Florida** area. We know it is important to offer options such as **distributed wastewater treatment systems** and to ensure that you are fully aware of how your new system will function. ![Distributed Wastewater Treatment Systems in Odessa, Florida](/wp-content/uploads/2022/04/20220303_154759-res.jpg) Distributed wastewater treatment systems are comparable to what most municipal plants use, but on a smaller scale. One of the biggest benefits of these systems is that there isn’t a need for a large-scale collection system. This means your initial capital investment will be lower. In addition, since the maintenance and operational costs are lower, you’ll save money going forward too. We can scale distributed wastewater treatment systems to any situation. There are many other benefits of **distributed wastewater treatment systems**, including environmental advantages. We are happy to meet with you to go over how these systems work and help you determine if installing one is the right option for your commercial or other development project. Our experience with septic engineering makes us an ideal choice if you are looking for a customized result that fits your objectives. We design, obtain permitting, and install all types of package plant systems. [Contact us](/contact-southern-water-and-soil/) today with any questions you might have or to schedule a consultation appointment. --- *At Southern Water and Soil, we offer **distributed wastewater treatment systems** in [Brooksville](/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/), [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/), [Fort Myers](/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/), Land O’ Lakes, Lutz, [Miami](/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/), **[Odessa](/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/), and [Tampa](/distributed-wastewater-treatment-systems-tampa-fl/), [Florida](/commercial-septic-florida/distributed-wastewater-treatment-systems/).* --- ### [Commercial Septic Company, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-company/) **Published:** March 23, 2026 **Author:** Southern Water Soil **Content:** ## We are a full-service commercial septic company that you can count on for professionalism, reliability, and quality. At Southern Water and Soil, we understand that when you need a **commercial septic company** for your **Odessa, Florida** business, you need to know they have experience with the complex nature of a commercial septic system. Let us put your mind at rest as we have more than 30 years of combined experience providing septic solutions for commercial applications. ![Commercial Septic Company in Odessa, Florida](/wp-content/uploads/2019/08/2012-11-21-10.29.41_res.jpg) Our experience includes designing a septic system for any size business. We take the time to learn what your needs are, the size and scope of your business operation, plans for the future, and any other relevant facts that will assist us in designing the best possible septic system for your needs. As a commercial septic company, we are responsible for the permitting process and will handle that in an expeditious and reliable manner so your project stays on schedule. When all the designing and permitting are concluded, the site prep work has been done, and your building site is ready for the septic system installation, we’ll handle it professionally and accurately so you can enjoy a fully functioning, efficient system for many years to come. As a full-service commercial septic company, we can also handle replacing a full septic system or any component that has failed. We also provide septic system maintenance and repair services to prevent future problems from unfolding due to insufficient care. We also do commercial real estate septic inspections, so be sure to call us while you are the due diligence period to be sure your purchase doesn’t come with unforeseen problems. If you have any questions we can answer as the preferred **commercial septic company** in the area, don’t hesitate to [reach out to us](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), **[Odessa](/commercial-septic-odessa-fl/commercial-septic-company/)**, Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Distributed Wastewater Treatment Systems, Florida](https://southernsepticanddesign.com/commercial-septic-florida/distributed-wastewater-treatment-systems/) **Published:** April 18, 2024 **Author:** Southern Water Soil **Content:** ## You can count on our team for effective wastewater treatment solutions. Our team at Southern Water and Soil has been designing and building wastewater treatment systems for over 30 years. Over the past three decades, we have worked with a wide range of clients on different types of properties, and we have created wastewater treatment systems tailored to each client’s specific needs. If your property is too far away from the nearest municipal water system to connect to it, you can turn to our team to get a solution that works for your private land. We have extensive experience in building **distributed wastewater treatment systems**, and we are confident that we can design a solution that will work best for your property. ![Distributed Wastewater Treatment Systems in Florida](/wp-content/uploads/2022/04/20220303_154759-res.jpg) Distributed wastewater treatment systems work on the same principles as larger treatment facilities, but they are compact enough to be used for private properties, including commercial complexes. The key difference between these two types of systems is their need for water collection. Our distributed wastewater treatment systems do not require large amounts of water, which means they are cheaper and easier to install and maintain. If you need a water treatment solution for your property, we encourage you to contact our team to learn more about these systems and how our technicians can help you. Our team is proud to serve clients throughout the state of **Florida**, and we want to assist you with all your water treatment needs. If you are interested in learning more about our **distributed wastewater treatment systems**, just [give us a call](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we offer **distributed wastewater treatment systems** in [Brooksville](/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/), [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/), [Fort Myers](/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/), Land O’ Lakes, Lutz, [Miami](/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/), [Odessa](/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/), and [Tampa](/distributed-wastewater-treatment-systems-tampa-fl/), [**Florida**](/commercial-septic-florida/distributed-wastewater-treatment-systems/).* --- ### [Distributed Wastewater Treatment Systems, Tampa, FL](https://southernsepticanddesign.com/distributed-wastewater-treatment-systems-tampa-fl/) **Published:** April 13, 2022 **Author:** Southern Water Soil **Content:** ## Distributed wastewater treatment systems are comparable to what most municipal plants use, but on a smaller scale. Wastewater treatment doesn’t look the same from one project to another. It takes significant experience and attention to innovations in the industry to be able to come up with reliable solutions. At Southern Water and Soil, we have over three decades of experience performing package plant installations in the **Tampa, Florida** area. We know it is important to offer options such as **distributed wastewater treatment systems** and to ensure that you are fully aware of how your new system will function. ![Distributed Wastewater Treatment Systems in Tampa, Florida](/wp-content/uploads/2022/04/20220303_154759-res.jpg) Distributed wastewater treatment systems are comparable to what most municipal plants use, but on a smaller scale. One of the biggest benefits of these systems is that there isn’t a need for a large-scale collection system. This means your initial capital investment will be lower. In addition, since the maintenance and operational costs are lower, you’ll save money going forward too. We can scale distributed wastewater treatment systems to any situation. There are many other benefits of **distributed wastewater treatment systems**, including environmental advantages. We are happy to meet with you to go over how these systems work and help you determine if installing one is the right option for your commercial or other development project. Our experience with septic engineering makes us an ideal choice if you are looking for a customized result that fits your objectives. We design, obtain permitting, and install all types of package plant systems. [Contact us](/contact-southern-water-and-soil/) today with any questions you might have or to schedule a consultation appointment. --- *At Southern Water and Soil, we offer **distributed wastewater treatment systems** in [Brooksville](/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/), [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/), [Fort Myers](/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/), Land O’ Lakes, Lutz, [Miami](/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/), [Odessa](/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/), and **[Tampa](/distributed-wastewater-treatment-systems-tampa-fl/)**, [Florida](/commercial-septic-florida/distributed-wastewater-treatment-systems/).* --- ### [Distributed Wastewater Treatment Systems, Miami, FL](https://southernsepticanddesign.com/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## Distributed wastewater treatment systems provide many benefits to you and your property. For decades, the traditional form of waste management for residential and commercial spaces has been relying on a city sewer system. In today’s world, advancements in septic system technology have produced alternative options, including **distributed wastewater treatment systems**. These systems function similarly to a municipal treatment plant, but instead of serving a wide area from one centralized location, distributed wastewater treatment systems focus on a smaller area, whether that be a small group of houses or a commercial space. ![Distributed Wastewater Treatment Systems in Miami, Florida](/wp-content/uploads/2022/04/20220303_154759-res.jpg) There are many benefits to relying on decentralized wastewater treatment. For one, there are significant savings with the initial capital investment, making it a more economical solution. These systems also have lower energy requirements. Utilizing a distributed wastewater treatment system is a much better alternative than the large-scale centralized systems that have a larger negative environmental impact. We here at Southern Water and Soil are septic engineering professionals with extensive experience in designing the perfect septic systems for our clients. We always keep up with the latest advancements in septic technology and are well-versed in designing, installing, and maintaining **distributed wastewater treatment systems**. We’ve seen how these systems benefit property owners in more ways than one, and we would be happy to discuss this waste management system with you to help you determine if it would be a good fit for your property. Never underestimate the importance of more efficient wastewater treatment. [Give us a call](/contact-southern-water-and-soil/) if you’re in the **Miami, Florida** area to learn more about our septic system services. --- *At Southern Water and Soil, we offer **distributed wastewater treatment systems** in [Brooksville](/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/), [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/), [Fort Myers](/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/), Land O’ Lakes, Lutz, [**Miami**](/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/), [Odessa](/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/), and [Tampa](/distributed-wastewater-treatment-systems-tampa-fl/), [Florida](/commercial-septic-florida/distributed-wastewater-treatment-systems/).* --- ### [Distributed Wastewater Treatment Systems, Fort Meyers, FL](https://southernsepticanddesign.com/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/) **Published:** December 19, 2023 **Author:** Southern Water Soil **Content:** ## Our team has the right experience to design the perfect distributed wastewater treatment systems for your needs. Our team at Southern Water and Soil has over three decades of experience in designing and installing wastewater treatment systems. We understand different properties require different water treatment solutions, and we can provide the best solutions for your specific requirements. For example, one of the options we offer is **distributed wastewater treatment systems**, which are similar to the systems used in municipal water treatment plants but small enough to be used on smaller private areas, including developments and commercial complexes. ![Distributed Wastewater Treatment Systems in Fort Meyers, Florida](/wp-content/uploads/2022/04/20220303_154759-res.jpg) Aside from their size, another key difference between municipal wastewater treatment systems and the distributed wastewater treatment systems we provide is the way they collect water—unlike a municipal system, a distributed system does not require large-scale water collection infrastructure. This makes our distributed systems cheaper and easier to install, and cheaper and easier to maintain in the long term. If you want to know more about how these systems work, we encourage you to give us a call to consult our experienced technicians. We will be happy to answer all your questions and to advise you on whether a distributed wastewater treatment system is the right fit for your needs. We are proud to serve the community here in **Fort Meyers, Florida**, and we want to help you handle the septic engineering required for your next project. If you are looking for a team with the right knowledge and experience to develop effective **distributed wastewater treatment systems**, just [give us a call](/contact-southern-water-and-soil/) to find out how to get started with our services. --- *At Southern Water and Soil, we offer **distributed wastewater treatment systems** in [Brooksville](/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/), [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/), [**Fort Myers**](/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/), Land O’ Lakes, Lutz, [Miami](/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/), [Odessa](/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/), and [Tampa](/distributed-wastewater-treatment-systems-tampa-fl/), [Florida](/commercial-septic-florida/distributed-wastewater-treatment-systems/).* --- ### [Distributed Wastewater Treatment Systems, Brooksville, FL](https://southernsepticanddesign.com/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## Our team offers distributed wastewater treatment systems to help you keep your costs and environmental impact down. At Southern Water and Soil, we specialize in providing septic and wastewater management solutions of all kinds. We have over 30 years of experience in the industry, and we serve a wide range of clients, including developers, business owners, homeowners, etc. In addition, our team makes a point to stay up to date with the latest advancements in septic management systems, and one such advancement that is gaining popularity is **distributed wastewater treatment systems**. ![Distributed Wastewater Treatment Systems in Brooksville, Florida](/wp-content/uploads/2022/04/20220303_154759-res.jpg) Distributed wastewater treatment systems function like the larger municipal treatment plants you are probably familiar with, but on a smaller scale. Instead of serving a wide area such as a city, they serve smaller communities, such as commercial campuses, neighborhoods, or small groups of homes. More and more developers and property owners are choosing distributed systems due to their lower installation costs and their lower energy requirements. If you are looking for a less expensive alternative to a standard municipal treatment plant or for a more environmentally friendly option, we encourage you to look into distributed wastewater treatment systems. Our team is proud to serve the community here in **Brooksville, Florida**, and we want to help you find the ideal septic solutions for your needs. If you are interested in learning more about our **distributed wastewater treatment systems**, simply [give us a call](/contact-southern-water-and-soil/). We will be happy to discuss your project requirements, and we will work with you to find the ideal solution for your wastewater management demands. You can count on us to help you find a system that works for you. --- *At Southern Water and Soil, we offer **distributed wastewater treatment systems** in **[Brooksville](/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/)**, [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/), [Fort Myers](/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/), Land O’ Lakes, Lutz, [Miami](/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/), [Odessa](/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/), and [Tampa](/distributed-wastewater-treatment-systems-tampa-fl/), [Florida](/commercial-septic-florida/distributed-wastewater-treatment-systems/).* --- ### [Distributed Wastewater Treatment Systems, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## Distributed wastewater treatment systems are comparable to what most municipal plants use, but on a smaller scale. Wastewater treatment doesn’t look the same from one project to another. It takes significant experience and attention to innovations in the industry to be able to come up with reliable solutions. At Southern Water and Soil, we have over three decades of experience performing package plant installations in the **Dade City, Florida** area. We know it is important to offer options such as **distributed wastewater treatment systems** and to ensure that you are fully aware of how your new system will function. ![Distributed Wastewater Treatment Systems in Dade City, Florida](/wp-content/uploads/2022/04/20220303_154759-res.jpg) Distributed wastewater treatment systems are comparable to what most municipal plants use, but on a smaller scale. One of the biggest benefits of these systems is that there isn’t a need for a large-scale collection system. This means your initial capital investment will be lower. In addition, since the maintenance and operational costs are lower, you’ll save money going forward too. We can scale distributed wastewater treatment systems to any situation. There are many other benefits of **distributed wastewater treatment systems**, including environmental advantages. We are happy to meet with you to go over how these systems work and help you determine if installing one is the right option for your commercial or other development project. Our experience with septic engineering makes us an ideal choice if you are looking for a customized result that fits your objectives. We design, obtain permitting, and install all types of package plant systems. [Contact us](/contact-southern-water-and-soil/) today with any questions you might have or to schedule a consultation appointment. --- *At Southern Water and Soil, we offer **distributed wastewater treatment systems** in [Brooksville](/commercial-septic-brooksville-fl/distributed-wastewater-treatment-systems/), **[Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/)**, [Fort Myers](/commercial-septic-fort-myers-fl/distributed-wastewater-treatment-systems/), Land O’ Lakes, Lutz, [Miami](/commercial-septic-miami-fl/distributed-wastewater-treatment-systems/), [Odessa](/commercial-septic-odessa-fl/distributed-wastewater-treatment-systems/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/), and [Tampa](/distributed-wastewater-treatment-systems-tampa-fl/), [Florida](/commercial-septic-florida/distributed-wastewater-treatment-systems/).* ### Similar Services We Offer: --- ### [Commercial Septic Drain Field, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-drain-field/) **Published:** August 17, 2017 **Author:** Southern Water Soil **Content:** ## We’ll make sure your commercial septic drain field is set up appropriately for your property and your business in Tampa. As you plan for your commercial septic system installation, you may be thinking of your tank and other septic components. However, there is one critical component that plays a significant role in the way your commercial septic system will work: the drain field. At Southern Water and Soil, our experienced team is equipped to provide commercial septic services, including the design, installation, and maintenance of your **commercial septic drain field** in Tampa, Florida. ![Commercial Septic Drain Field in Tampa, Florida](/wp-content/uploads/2017/08/commercialseptic-drain-field.jpg) - **Installation** – From the moment you determine you want to break ground on a new commercial business site, you can rely on our team at Southern Water and Soil to provide the commercial septic services you need. We’ll make sure your commercial septic drain field is set up appropriately for your property and your business. - **Maintenance** – Proper maintenance of your commercial septic drain field is essential and easily achieved when you schedule routine septic tank cleaning and inspections. We’ll be happy to keep your drain field in top working condition. - **Repair** – If you have noticed that your commercial septic drain field is not functioning properly, or that your other septic system components haves suffered damage, make sure to contact us at Southern Water and Soil right away for repair solutions. We’ll help you get your **commercial septic drain field** working its best again. At Southern Water and Soil, our team has over three decades of experience providing a wide range of commercial septic services, from permitting through completed installation in Tampa. [Contact us](/contact-southern-water-and-soil/) today if you require a commercial septic company that is knowledgeable about a variety of commercial septic applications and can provide the services you need. --- *At Southern Water and Soil, we install **commercial septic drain fields** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/), [Dade City](/commercial-septic-drain-field-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-drain-field/), Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-drain-field/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/), and **[Tampa](/commercial-septic-drain-field-tampa-fl/)**, Florida.* --- ### [Commercial Septic Drain Field, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/commercial-septic-drain-field/) **Published:** January 15, 2024 **Author:** Southern Water Soil **Content:** ## You can count on us to design and maintain the commercial septic drain field for your property. All septic systems have two main parts: the tank and the drain field. As waste flows from your building’s pipes and into the tank, all solid waste will sink to the bottom, where it will remain until it is removed via pumping. Liquid effluent, on the other hand, will flow out into the drain field, a network of pipes and filters designed to remove toxic substances from the liquid and to gradually let the water seep back into the ground. The larger the septic system, the larger the drain field, so systems serving commercial properties need to be large indeed. If you need help to maintain or install a **commercial septic drain field** on your property, you can turn to our team at Southern Water and Soil. ![Commercial Septic Drain Field in Spring Hill, Florida](/wp-content/uploads/2017/08/commercialseptic-drain-field.jpg) Our team has been working in the septic and wastewater management industries for over 30 years, and we have extensive experience working with both residential and commercial clients. Whether you are developing a new commercial property and need us to install a new septic system or need help maintaining the one you already have, you can turn to us to get the reliable solutions you are looking for. We have the right knowledge and experience to design, build, and maintain high-quality commercial septic drain fields for businesses of all kinds. We are proud to be part of the community here in **Spring Hill, Florida**, and we want to help you do what’s best for your business. If you are looking for **commercial septic drain field** services of any kind, simply [give us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **commercial septic drain fields** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/), [Dade City](/commercial-septic-drain-field-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-drain-field/), Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-drain-field/), Orlando, Plant City, Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/)**, and [Tampa](/commercial-septic-drain-field-tampa-fl/), Florida.* ### Similar Services We Offer: --- ### [Commercial Septic Drain Field, Fort Myers, FL](https://southernsepticanddesign.com/commercial-septic-fort-myers-fl/commercial-septic-drain-field/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## We can maintain and repair all components of your commercial septic system. A **commercial septic drain field** that works properly is necessary for managing wastewater efficiently without causing harm to the nearby environment. The drain field, which is also called a leach field or an absorption field, is a vital part of the septic system. At Southern Water and Soil, we can help you keep your commercial septic drain field in good working order, ensuring the safety and health of all involved. ![Commercial Septic Drain Field in Fort Myers, Florida](/wp-content/uploads/2017/08/commercialseptic-drain-field.jpg) A commercial septic drain field lets treated wastewater slowly seep into the ground, making sure that only clean water goes into the groundwater system by getting rid of any leftover impurities and contaminants. If the drain field isn’t working right or becomes flooded, poorly treated wastewater could end up in the wrong place. Unfortunately, this can pollute the groundwater, surface water, and even the soil close by. Keeping up with regular maintenance and making sure that your commercial septic drain field works reliably will help your septic system last longer and work better overall. In addition, taking care of the system properly can help avoid problems like clogging and dirt compaction, which can make it less effective at treating wastewater. Furthermore, all businesses must follow local, state, and federal rules when it comes to properly treating wastewater. To comply with these regulations, the commercial septic drain field must work properly and efficiently. As a key part of a septic system, it’s essential to ensure that your **commercial septic drain field** gets regular inspections, upkeep, and quick repairs. [Contact our team](/contact-southern-water-and-soil/) in the **Fort Myers, Florida** area to learn more or schedule a service today. --- *At Southern Water and Soil, we install **commercial septic drain fields** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/), [Dade City](/commercial-septic-drain-field-brandon/), [**Fort Myers**](/commercial-septic-fort-myers-fl/commercial-septic-drain-field/), Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-drain-field/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/), and [Tampa](/commercial-septic-drain-field-tampa-fl/), Florida.* --- ### [Commercial Septic Drain Field, Brooksville, FL](https://southernsepticanddesign.com/commercial-septic-brooksville-fl/commercial-septic-drain-field/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## We can design a commercial septic drain field for your property. Proper waste treatment is essential for your property, and if you must rely on a commercial septic system instead of a sewer system, then we are the team to trust when it comes to its design. At Southern Water and Soil, we have three decades of experience in the septic industry and are experts in the design, engineering, and installation of commercial septic systems. Rely on our team for all your septic needs in **Brooksville, Florida**. ![Commercial Septic Drain Field in Brooksville, Florida](/wp-content/uploads/2017/08/commercialseptic-drain-field.jpg) One important aspect of your septic system is the drain field, the designated area where liquid effluent is released into the soil via perforated pipes. There’s no such thing as a one-size-fits-all drain field, considering every property is different with different geographical features and types of soil. We will survey your property and create your **commercial septic drain field** after accounting for the factors that are unique to your property. There are many different types of commercial septic drain fields we can install. For example, engineered drip septic systems are suitable for some properties. This drip irrigation septic system features a shallow drain field where water trickles out over a wide area. By installing flexible piping around trees and shrubs, we can more easily fit a drain field in an established landscape. Of course, this is not the only drain field option we offer, and we will customize yours to your specific needs. [Contact us today](/contact-southern-water-and-soil/) to learn more about **commercial septic drain fields** and how our team can help. --- *At Southern Water and Soil, we install **commercial septic drain fields** in [**Brooksville**](/commercial-septic-brooksville-fl/commercial-septic-drain-field/), [Dade City](/commercial-septic-drain-field-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-drain-field/), Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-drain-field/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/), and [Tampa](/commercial-septic-drain-field-tampa-fl/), Florida.* ### Similar Services We Offer: --- ### [Commercial Septic Drain Field, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-drain-field/) **Published:** October 31, 2018 **Author:** Southern Water Soil **Content:** ## Let us help you keep your commercial drain field in good shape. As a business owner with a septic system in use at your facilities or office, you are highly familiar with the way your drain field works and what you need to do to maintain its delicate balance of waste and water. Despite this knowledge, you have many tasks to attend to daily to keep your business up and running, so keeping consistent tabs on your drain field may fall to the wayside. ![Commercial Septic Drain Field in Dade City, Florida](/wp-content/uploads/2017/08/commercialseptic-drain-field.jpg) Luckily, you have us at Southern Water and Soil to offer the **commercial septic drain field** services you need and want in Dade City, Florida. From fixing a malfunctioning system to designing and installing a system from scratch according to your requirements, we offer the extensive know-how, experience, and industry qualifications to do whatever you need. One of the most important aspects of keeping your commercial septic drain field in good shape is to keep grease out of your system. Especially if you run a restaurant or another type of food-processing operation, use of a grease trap is highly recommended. If you have yet to implement one of these systems at your location or need help cleaning a current one out, turn to us for help. For all of your **commercial septic drain field** needs, whether repair, maintenance, installation or just for advice, Southern Water and Soil is your top source here in Dade City. Schedule maintenance or speak to one of our professionals about your installation needs by giving us a [call today](/contact-southern-water-and-soil/)! --- *At Southern Water and Soil, we install **commercial septic drain fields** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/), [**Dade City**](/commercial-septic-drain-field-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-drain-field/), Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-drain-field/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/), and [Tampa](/commercial-septic-drain-field-tampa-fl/), Florida.* --- ### [Commercial Septic Drain Field, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-drain-field/) **Published:** March 23, 2026 **Author:** Southern Water Soil **Content:** ## Let us help you keep your commercial drain field in good shape. As a business owner with a septic system in use at your facilities or office, you are highly familiar with the way your drain field works and what you need to do to maintain its delicate balance of waste and water. Despite this knowledge, you have many tasks to attend to daily to keep your business up and running, so keeping consistent tabs on your drain field may fall to the wayside. ![Commercial Septic Drain Field in Odessa, Florida](/wp-content/uploads/2017/08/commercialseptic-drain-field.jpg) Luckily, you have us at Southern Water and Soil to offer the **commercial septic drain field** services you need and want in **Odessa, Florida**. From fixing a malfunctioning system to designing and installing a system from scratch according to your requirements, we offer the extensive know-how, experience, and industry qualifications to do whatever you need. One of the most important aspects of keeping your commercial septic drain field in good shape is to keep grease out of your system. Especially if you run a restaurant or another type of food-processing operation, use of a grease trap is highly recommended. If you have yet to implement one of these systems at your location or need help cleaning a current one out, turn to us for help. For all of your **commercial septic drain field** needs, whether repair, maintenance, installation or just for advice, Southern Water and Soil is your top source here in Odessa. Schedule maintenance or speak to one of our professionals about your installation needs by giving us a [call today](/contact-southern-water-and-soil/)! --- *At Southern Water and Soil, we install **commercial septic drain fields** in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/), [Dade City](/commercial-septic-drain-field-brandon/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-drain-field/), Land O’ Lakes, Lutz, Miami, **[Odessa](/commercial-septic-odessa-fl/commercial-septic-drain-field/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/), and [Tampa](/commercial-septic-drain-field-tampa-fl/), Florida.* --- ### [Commercial Septic Company, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-company/) **Published:** August 30, 2019 **Author:** Southern Water Soil **Content:** ## We are a full-service commercial septic company that you can count on for professionalism, reliability, and quality. ![Commercial Septic Company in Dade City, Florida](/wp-content/uploads/2019/08/2012-11-21-10.29.41_res.jpg) At Southern Water and Soil, we understand that when you need a **commercial septic company** for your Dade City, Florida business, you need to know they have experience with the complex nature of a commercial septic system. Let us put your mind at rest as we have more than 30 years of combined experience providing septic solutions for commercial applications. Our experience includes designing a septic system for any size business. We take the time to learn what your needs are, the size and scope of your business operation, plans for the future, and any other relevant facts that will assist us in designing the best possible septic system for your needs. As a commercial septic company, we are responsible for the permitting process and will handle that in an expeditious and reliable manner so your project stays on schedule. When all the designing and permitting are concluded, the site prep work has been done, and your building site is ready for the septic system installation, we’ll handle it professionally and accurately so you can enjoy a fully functioning, efficient system for many years to come. As a full-service commercial septic company, we can also handle replacing a full septic system or any component that has failed. We also provide septic system maintenance and repair services to prevent future problems from unfolding due to insufficient care. We also do commercial real estate septic inspections, so be sure to call us while you are the due diligence period to be sure your purchase doesn’t come with unforeseen problems. If you have any questions we can answer as the preferred **commercial septic company** in the area, don’t hesitate to [reach out to us](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), **[Dade City](/commercial-septic-brandon/commercial-septic-company/)**, [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic Company, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-company/) **Published:** August 17, 2017 **Author:** Southern Water Soil **Content:** ## Managing your commercial septic system begins with knowing you have a reliable commercial septic company in Tampa. ![Commercial Septic Company in Tampa, Florida](/wp-content/uploads/2017/08/commercial-septic-company-300x188.jpg)At Southern Water and Soil, we understand that managing your commercial septic system can often begin with knowing you have a reliable **commercial septic company** available to provide the services you need. Whether it’s a minor repair, routine maintenance, or completing installation, having a team of septic professionals to assist you can achieve the best outcomes for your business. Our team at Southern Water and Soil has over 30 years of experience providing septic solutions for commercial businesses, and you will find that we are your commercial septic company of choice in Tampa, Florida. - **Permitting** – As a commercial septic company, we understand that having the proper permits is an essential step in the setup and operating of your business’ septic system. We are knowledgeable about the requirements for commercial septic installation and maintenance and can help with the permitting process. - **Design** – Are you breaking ground on a new commercial business that will have a septic system installed? Allow us to provide the expert design services you need for the best outcomes as your business gets ready for opening. - **Installation** – At Southern Water and Soil, we are equipped to address all types of commercial septic system installation, whether you are starting from scratch or replacing a specific part. We can work with you to design and install the septic system that will work best for your business facility. - **Maintenance** – As a **commercial septic company** in Tampa, we always recommend routine maintenance and servicing of your septic system. We’ll be happy to discuss the maintenance schedule that will ensure your septic system is effective and efficient year after year. --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and **[Tampa](/commercial-septic-tampa-fl/commercial-septic-company/)**, [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic Company, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/commercial-septic-company/) **Published:** February 16, 2026 **Author:** Southern Water Soil **Content:** ## We are a full-service commercial septic company that you can count on for professionalism, reliability, and quality. At Southern Water and Soil, we understand that when you need a **commercial septic company** for your **Spring Hill, Florida** business, you need to know they have experience with the complex nature of a commercial septic system. Let us put your mind at rest as we have more than 30 years of combined experience providing septic solutions for commercial applications. ![Commercial Septic Company in Spring Hill, Florida](/wp-content/uploads/2019/08/2012-11-21-10.29.41_res.jpg) Our experience includes designing a septic system for any size business. We take the time to learn what your needs are, the size and scope of your business operation, plans for the future, and any other relevant facts that will assist us in designing the best possible septic system for your needs. As a commercial septic company, we are responsible for the permitting process and will handle that in an expeditious and reliable manner so your project stays on schedule. When all the designing and permitting are concluded, the site prep work has been done, and your building site is ready for the septic system installation, we’ll handle it professionally and accurately so you can enjoy a fully functioning, efficient system for many years to come. As a full-service commercial septic company, we can also handle replacing a full septic system or any component that has failed. We also provide septic system maintenance and repair services to prevent future problems from unfolding due to insufficient care. We also do commercial real estate septic inspections, so be sure to call us while you are the due diligence period to be sure your purchase doesn’t come with unforeseen problems. If you have any questions we can answer as the preferred **commercial septic company** in the area, don’t hesitate to [reach out to us](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/)**, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic Company, Plant City, FL](https://southernsepticanddesign.com/commercial-septic-plant-city-fl/commercial-septic-company/) **Published:** February 3, 2020 **Author:** Southern Water Soil **Content:** ## We are a commercial septic company that’s ready and willing to help you with any of your commercial septic needs in Plant City. ![Commercial Septic Company in Plant City, Florida](/wp-content/uploads/2019/08/2012-11-21-10.29.41_res.jpg) When you are looking for a septic company that can take care of your residence in the Plant City, Florida area, you have several choices to choose from. However, if you are looking for a **commercial septic company** in Plant City, then you need to check us out here at Southern Water and Soil! At Southern Water and Soil, we have over 30 years of experience taking care of all your septic needs, including those that are unique to commercial properties. A commercial property often requires a different setup and much more planning and consideration before moving forward with a septic system installation. Because we have been helping businesses in the area like yours for so many years, we don’t skip a beat when it comes to large and complex commercial septic installation or replacement issues that you might be wondering about. We know what steps we will need to take both legally and in terms of which tank and layout will be best for your specific needs, allowing us to work efficiently and get your work done in an appropriate timeline for you. Once we have determined the size, scope and location of your septic system installation or replacement, we can get to work. If you already have a working system in place, we are happy to help you with routine repairs and maintenance as well. These more frequent and ever-important steps are what keep your commercial septic system running smoothly without mishaps that can cost your company valuable production time. With the help of our **commercial septic company**, your septic system can always be in tip-top shape. For more information about how we can help you, [give us a call](/contact-southern-water-and-soil/) at Southern Water and Soil today! --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, **[Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/)**, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic Company, Miami, FL](https://southernsepticanddesign.com/commercial-septic-miami-fl/commercial-septic-company/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## We serve commercial properties both big and small with waste management solutions. Many commercial spaces rely on septic systems for their waste management needs. This is because septic systems can be customized in their size or design to accommodate your commercial space’s specific needs and situations. The specifications behind your septic system will rely on factors like how big your facility is, how many people use the facility, and more. ![Commercial Septic Company in Miami, Florida](/wp-content/uploads/2023/12/2012-11-21-10.30.10-res.jpg) A good **commercial septic company** will be able to provide you with a system that’s been perfectly engineered for your commercial space, and that’s exactly what we do here at Southern Water and Soil. We’re experts in all things septic system-related, from servicing drain fields to pumping out your septic tank. Our services start with speaking with you about your needs for a septic system. From there, we’ll help you design and engineer a system tailored to your property’s needs and layout. Our commercial septic company places our clients at the forefront of what we do, and that begins with making sure you’re always treated like an individual with unique needs. If you’re looking for a **commercial septic company** here in **Miami, Florida**, you won’t find a better team than us. Working with septic systems at every stage of their development is what we specialize in, and for over 30 years, we’ve been providing septic services with professionalism and skill in mind. It’s important to us that you’re satisfied with the results of our work, so we’re dedicated to doing the job right the first time. [Give us a call](/contact-southern-water-and-soil/) today for the best commercial septic services around. --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [**Miami**](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic Company, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-company/) **Published:** September 17, 2019 **Author:** Southern Water Soil **Content:** ## We have more than 30 years of experience as a commercial septic company you can trust for installation, maintenance, and repairs. ![Commercial Septic Company in Lutz, Florida](/wp-content/uploads/2017/08/commercial-septic-company.jpg) At Southern Water and Soil, we understand that the success of your business in Lutz, Florida can be undermined by a septic system problem. The best way to avoid a disruption that lowers your profits is to have a reliable and experienced **commercial septic company** handling your septic needs. We bring more than 30 years of experience to the table, so it is safe to say that we can provide the best septic solutions for your company. If you are just getting started or opening another location, your buildout may require a **commercial septic company** to install a system for you. We are fully equipped to design and install a septic system that will give you several decades of reliable performance. We handle installations in an organized manner, obtaining all permits needed, and completing the project on time so the next phase of the build is not delayed. Whether we installed your septic system or another commercial septic company did, you can confidently turn to us for maintenance, minor repairs, or to get answers to any questions you have about proper operation and care of your company’s septic system. We can be a valuable resource for keeping your septic tank and drain field operating as they should. Our commercial septic company is equipped to handle any type of commercial septic system, including package plant installations, aerobic septic systems, performance-based septic systems, and passive nitrogen septic systems. We also perform commercial real estate septic inspections, so if you are purchasing an existing property, have us check it out before you close so any issues can be addressed. We look forward to being the commercial septic company you turn to for all your septic needs. --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), **[Lutz](/commercial-septic-lutz-fl/commercial-septic-company/)**, [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic Company, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-company/) **Published:** December 26, 2019 **Author:** Southern Water Soil **Content:** ## Don’t settle for less than a highly qualified commercial septic company. ![Commercial Septic Company in Land O’ Lakes, Florida](/wp-content/uploads/2017/08/commercial-septic-company.jpg) At Southern Water and Soil, we recognize that as a business owner or commercial property owner, you have a lot at stake when it comes to the performance of the septic system. You need to have confidence in the commercial septic company you use for a new septic system, or to repair or replace your current one. With 30 years of combined experience in the septic industry, we are a trusted **commercial septic company** serving the Land O’ Lakes, Florida area. For new construction and replacement, you can count on us to handle everything, including providing septic system engineering services, commercial septic system design, permit application services, and backing the results with our septic system warranty packages. We are adept with drainage systems to ensure you get a long, trouble-free life from your septic system. As a full-service commercial septic company, we can also handle package plant installations, including effluent sewers and cluster wastewater treatment. We are knowledgeable about various types of septic systems, including performance-based septic systems, passive nitrogen septic systems, and aerobic septic systems. We also perform commercial real estate septic inspections, so if you are planning to purchase an existing commercial property, call us before you close to be sure the septic system is in good shape. If you have any questions about what services we offer as a premier **commercial septic company**, don’t hesitate to [reach out to us](/contact-southern-water-and-soil/). We look forward to providing you with superior septic services so that you’ll have peace of mind that your company’s business operations won’t be derailed by a major septic problem. --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), **[Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/)**, [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic Company, Fort Meyers, FL](https://southernsepticanddesign.com/commercial-septic-fort-myers-fl/commercial-septic-company/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## When you need a commercial septic company, turn to our team to get the superior results you’re looking for. In Florida, septic systems are very common, and they are used for both homes and businesses. However, not every septic company has the necessary experience to handle both types of systems. For example, most residential septic companies can’t handle the larger, more complex commercial systems. If you are looking for a **commercial septic company** you can trust, just turn to our team at Southern Water and Soil. We have been working in this business for over 30 years, and you can count on us to deliver the outstanding results you deserve. ![Commercial Septic Company in Fort Meyers, Florida](/wp-content/uploads/2019/08/2012-11-21-10.29.41_res.jpg) Over the years, our commercial septic company has worked with clients in a wide range of industries, and we have designed and built systems for operations of all sizes. Whether you need a septic system that can serve a massive industrial complex or a modest storefront, we’ve got you covered. In addition, we will adjust our designs to suit your current needs while also keeping your future plans in mind, making it easy for you to expand your facilities when the time comes. Our team will take care of every step of the process, from getting the necessary permits to putting the finishing touches on your new septic system and hooking it up to the plumbing. We are proud to serve the **Fort Meyers, Florida** area, and we want to provide the expert septic services you need for your next project. If you are looking for a **commercial septic company** you can count on to deliver outstanding results, just [give us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, our **commercial septic company** proudly serves [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/), [Dade City](/commercial-septic-brandon/commercial-septic-company/), [**Fort Myers**](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic Company, Brooksville, FL](https://southernsepticanddesign.com/commercial-septic-brooksville-fl/commercial-septic-company/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## You can count on our commercial septic company to provide the effective solutions you need. Our team at Southern Water and Soil knows your business is important to you, and we want to help you do what’s best for it. One thing every business needs, regardless of size, is a reliable way to deal with septic waste. While many businesses connect their facilities to municipal sewer systems for this purpose, many others use private septic systems to handle their waste. If you choose the second option, you will need the help of a reliable **commercial septic company** like ours. We can provide all the services you need to ensure your septic system continues to serve your business well. ![Commercial Septic Company in Brooksville, Florida](/wp-content/uploads/2019/08/2012-11-21-10.29.41_res.jpg) We have been working in the septic industry for over 30 years, and we have extensive experience in serving commercial clients. When you need a **commercial septic company**, you can count on, simply turn to our team. We will work with you to figure out the best way to address your septic needs, handling all the design and installation work for you. Our team also offers repair and maintenance services to ensure your system remains in good working order, so don’t hesitate to give us a call if you are experiencing issues of any kind with your septic infrastructure. We are proud to serve the **Brooksville, Florida** area, and we want to help you manage all your septic needs. If you are looking for a reliable commercial septic company, we encourage you to [reach out to our team](/contact-southern-water-and-soil/) to learn more about how we can assist you. --- *At Southern Water and Soil, our **commercial septic company** proudly serves **[Brooksville](/commercial-septic-brooksville-fl/commercial-septic-company/)**, [Dade City](/commercial-septic-brandon/commercial-septic-company/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-company/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-company/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-company/), [Miami](/commercial-septic-miami-fl/commercial-septic-company/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-company/), Orlando, [Plant City](/commercial-septic-plant-city-fl/commercial-septic-company/), Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-company/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-company/), [Florida](/commercial-septic-florida/commercial-septic-company/).* --- ### [Commercial Septic System Engineering, Orlando, FL](https://southernsepticanddesign.com/commercial-septic-orlando-fl/commercial-septic-system-engineering/) **Published:** October 18, 2017 **Author:** Southern Water Soil **Content:** ## Our team is qualified to provide commercial septic system engineering that is customized for your unique property in Orlando. ![Commercial Septic System Engineering in Orlando, Florida](/wp-content/uploads/2017/10/Commercial-Septic-System-Engineering.jpg) When you require new commercial septic system design and installation, you will find no better team for these important commercial septic system engineering tasks than ours at Southern Water and Soil. If your usual septic company doesn’t provide these services or you haven’t yet found a company that can provide reliable solutions in Orlando, Florida, you can always call on us at Southern Water and Soil. Our highly trained team is qualified to provide **commercial septic system engineering** that is expertly designed, operates dependably, and is customized for your unique commercial property. We will arrive on-schedule, ensure that you feel confident in the plans that are mapped out for design and installation, and provide routine updates throughout the commercial septic system engineering process. We are knowledgeable about the septic system permitting process and can also give you insights into the best way to care for your commercial septic system, so it operates most effectively for the long term. Our goal is to provide you with the most efficient and effective commercial septic system, so your business or your community has a reliable wastewater management system to meet your needs. At Southern Water and Soil, we know that choosing the right company for your **commercial septic system engineering** is a crucial step in the design and installation process. We also know that you won’t need to turn anywhere else once you’ve worked with our team. We accept nothing less than your complete satisfaction. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today to learn more about our services and to schedule a consultation. --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, Dade City, Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), **[Orlando](/commercial-septic-orlando-fl/commercial-septic-system-engineering/)**, Plant City, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), Florida.* --- ### [Commercial Septic System Engineering, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-system-engineering/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Excerpt:** We offer commercial septic system engineering for projects of all sizes, ranging from small schools to large office buildings to strip malls. **Content:** ## Our team has 30 years of combined experience in commercial septic system engineering in the Dade City, FL area. ![Commercial Septic System Engineering in Dade City, Florida](/wp-content/uploads/2014/07/2011-03-17-17.29.27-e1408945608278-300x178.jpg)At Southern Water & Soil, our team has 30 years of combined experience in commercial septic system engineering. We have completed projects for commercial buildings and companies throughout our service area, which includes **Dade City, Florida** and surrounding areas. When we start with your **commercial septic system engineering** project, we will create a customized proposal that includes as many options as you are interested in for your building. After you decide what plan you like, we will start obtaining licenses and permits from the local state department. We offer commercial septic system engineering for projects of all sizes, ranging from small schools to large office buildings to parking structures. When our team creates your proposal and plan, we will work with you to make sure your needs are met. We understand the needs of small business owners, so we make sure every project we plan is reasonable and affordable. We use high-quality equipment for every project we complete, ensuring long-lasting results every time you flush or drain water from your office. We have also designed commercial systems for drip irrigation, which is useful to reduce the footprint of your wastewater system. This allows for more parking spaces, RV Units, mobile homes, or whatever else is desired for your buildout. Our team can build large-scale systems that accommodate very large buildings with multiple drains and toilets on each floor. When we complete your project, the final step is education. We will explain the importance and function of each aspect of the system, so you know what to look for in case there are any potential problems. Please [contact us](/contact-southern-water-and-soil/ "commercial septic systems experts") today with any questions you have about **commercial septic system engineering**. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [**Dade City**](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-engineering/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), [Florida](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Commercial Septic System Engineering, Florida](https://southernsepticanddesign.com/commercial-septic-florida/commercial-septic-system-engineering/) **Published:** June 27, 2023 **Author:** Southern Water Soil **Content:** ## We can engineer commercial septic systems of all capacities. ![Commercial Septic System Engineering in Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2014/07/2011-03-17-17.29.27-e1408945608278-300x178.jpg?lossy=1&strip=0&webp=1)Commercial septic system engineering involves designing, installing, and managing a septic system that has commercial and industrial properties. The **commercial septic system engineering** process involves several key parts, but it typically starts with a comprehensive design phase. During this phase, commercial septic engineers will assess the wastewater needs of the commercial property and design a septic system that meets certain requirements. These requirements may include: - The size of the system. - The type and volume of wastewater that will be generated. - Components that will be needed, such as drain fields, distribution lines, and tanks. After the design is complete, the next phase in the commercial septic system engineering process involves obtaining all necessary permits to start construction. Once these permits are obtained, construction of the new septic system can begin. If you are looking for a commercial septic system engineering firm in **Florida** known for its experience and solutions, turn to us at Southern Water and Soil. We can handle all phases of your septic system engineering project, including design, permitting, installation, and beyond. Our goal is to design and maintain septic systems that effectively treat and dispose of wastewater while minimizing environmental impact and complying with sanitation and health regulations. Proper engineering plays a critical role in ensuring the new septic system functions well and lasts for as long as possible. Our **commercial septic system engineering** team is ready and waiting to get started on your project. For more information or to schedule an assessment with our team, [contact us today](/contact-southern-water-and-soil/). #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) ### Commercial Septic System Engineering Our experts are here to address your commercial septic system engineering needs, whether your system needs to be updated or you need one designed and installed for the first time on your property. With our expertise and commitment to protecting the environment, we are able to provide exceptional engineering services. Check out our frequently asked questions below and contact us to learn more about commercial septic system engineering. ##### Hidden ##### Why should I choose you for commercial septic system engineering? Not only do we have three decades of experience, but we are skilled in communicating with our customers, making sure to illustrate all their options clearly. We will ensure you understand the specific factors affecting your property and the regulations we must abide by when we handle your commercial [septic system](/residential-septic-services-dade-city-fl/septic-systems/) engineering. ##### What do I need to know about Florida’s Basin Management Action Plans (BMAPs)? The state of Florida has mandated a significant reduction in the level of pollutants affecting groundwater, fresh water, and the ocean. The excess nutrients, including nitrogen, that come from septic systems harm the environment, but the new BMAP rules identify specific properties that must make changes to their septic system to minimize pollution in the watershed. ##### Do you engineer low nitrogen septic systems? We do. We can survey your property and discuss the project with you before designing your system and obtaining permits. ##### What are septic to sewer conversions? Some properties in Florida must convert from septic systems to managed sewer systems to reduce watershed pollution. If your commercial property is identified as one of them, we can handle the conversion. ### Contact Southern Water and Soil Today! [Contact Us](#) *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-engineering/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), [**Florida**](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Commercial Septic System Engineering, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-system-engineering/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Excerpt:** We offer commercial septic system engineering for projects of all sizes, ranging from small schools to large office buildings to strip malls. **Content:** ## Our team has 30 years of combined experience in commercial septic system engineering in the Tampa, FL area. ![Commercial Septic System Engineering](/wp-content/uploads/2014/07/2011-03-17-17.29.27-e1408945608278-300x178.jpg)At Southern Water & Soil, our team has 30 years of combined experience in commercial septic system engineering. We have completed projects for commercial buildings and companies throughout our service area, which includes **Tampa, Florida** and surrounding areas. When we start with your **commercial septic system engineering** project, we will create a customized proposal that includes as many options as you are interested in for your building. After you decide what plan you like, we will start obtaining licenses and permits from the local state department. We offer commercial septic system engineering for projects of all sizes, ranging from small schools to large office buildings to parking structures. When our team creates your proposal and plan, we will work with you to make sure your needs are met. We understand the needs of small business owners, so we make sure every project we plan is reasonable and affordable. We use high-quality equipment for every project we complete, ensuring long-lasting results every time you flush or drain water from your office. We have also designed commercial systems for drip irrigation, which is useful to reduce the footprint of your wastewater system. This allows for more parking spaces, RV Units, mobile homes, or whatever else is desired for your buildout. Our team can build large-scale systems that accommodate very large buildings with multiple drains and toilets on each floor. When we complete your project, the final step is education. We will explain the importance and function of each aspect of the system, so you know what to look for in case there are any potential problems. Please [contact us](/contact-southern-water-and-soil/ "commercial septic systems experts") today with any questions you have about **commercial septic system engineering**. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-engineering/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and **[Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering)**, [Florida](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Commercial Septic System Engineering, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-system-engineering/) **Published:** September 29, 2015 **Author:** Southern Water Soil **Content:** ## Florida state law requires any septic drain field larger than 1,000 square feet to be designed by a commercial septic system engineering expert. **![Commercial Septic System Engineering](/wp-content/uploads/2015/09/2014-01-11-00.12-resized-300x300.jpg)Commercial septic system engineering** is necessary for most if not all commercial septic systems for a number of reasons. Because of these multiple considerations, as well as the variable laws, regulations, and rules regarding commercial septic systems, getting the engineering right will ensure a fully functional and worry-free septic system for years to come. First, the volume of waste in a commercial setting is often much higher than a standard residential system. This can place an additional load on a septic system and often requires a much larger tank than most residential properties will ever need. The second major consideration in **commercial septic system engineering** is the sewage strength. Higher usage rates and the prevalence of low-flow fixtures in businesses combine to make the sewage entering a commercial septic system many times stronger than what a residential system is rated to handle. The third consideration is the precise needs of your property. Office buildings generally need different septic systems than someone with a large property but less-intense use. Fourth, and perhaps most importantly, Florida state law requires any septic drain field larger than 1,000 square feet to be designed by an engineer. Getting the right system for your property and your needs often requires professional commercial septic system engineering even if your property will require a drain field smaller than 1,000 square feet, and Southern Water and Soil has many years of experience in the **Odessa, Florida** area with all aspects of septic systems, including the design, engineering, permitting, and installation of septic systems for commercial properties. Let us help you today! #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-engineering/), **[Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/)**, Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), [Florida](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Commercial Septic System Engineering, Miami, FL](https://southernsepticanddesign.com/commercial-septic-miami-fl/commercial-septic-system-engineering/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## Septic system engineering makes treating your business’s waste efficient and reliable. Most technology is constantly evolving to become more efficient and reliable. Septic system technology is no exception to this, and over the years, **commercial septic system engineering** has made designing and installing commercial septic systems more beneficial to property owners and managers. Advancements in this field have made working within specific physical constraints and local regulations much easier while still effectively treating the waste that your commercial space produces. ![Commercial Septic System Engineering in Miami, Florida](/wp-content/uploads/2024/02/2011-03-17-17.29.12-res.jpg) Commercial septic system engineering involves looking at how to best suit your specific needs for your commercial space while taking full advantage of modern technological advancements. The best septic companies will follow along with these advancements, and here at Southern Water and Soil, we are dedicated to staying up to date with modern **commercial septic system engineering** methods and technologies to enhance our already excellent septic services. If you’re in the **Miami, Florida** area and are looking for a commercial septic company that combines modern septic technology with tried-and-true expert workmanship, we’ve got you covered. We work with you to develop innovative solutions to your septic problems and needs, and our septic system engineering is sure to give you a septic system that you can rely on for years to come. We’ve been in the septic system industry for over 30 years, and in that time, we’ve constantly kept up with the latest and greatest methods of designing, installing, repairing, and maintaining septic systems for both commercial and residential properties. [Give our team a call](/contact-southern-water-and-soil/) today for septic engineering services to benefit your property. --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), [**Miami**](/commercial-septic-miami-fl/commercial-septic-system-engineering/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), [Florida](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Commercial Septic System Engineering, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-system-engineering/) **Published:** January 20, 2016 **Author:** Southern Water Soil **Content:** ## Call today to schedule a free consultation on your commercial septic system engineering job in Lutz, FL. ![Commercial Septic System Engineering, Lutz, FL](/wp-content/uploads/2016/01/2012-01-26-13.32.59-179x300.jpg)You might be able to purchase a septic tank and install it yourself, but it is not recommended. Not only does it require a good deal of experience to properly install a septic tank, but it also takes a certain degree of knowledge to choose the right tank. To make sure that your Lutz, FL business is properly outfitted with a septic system, be sure to contact us at Southern Water and Soil for **commercial septic system engineering**. When you hire our team for your **commercial septic system engineering** project, you know that you will be working with the best in the business. We will send a team of experienced septic engineers to your property to assess your needs and custom-design a septic system for you. When it comes time for the installation, we will walk you through the process, so you know exactly what is happening every step of the way. We have more than 30 years of experience in the septic industry, so you can count on us to do things right. Designing a custom septic system is no easy task, so you want to make sure you hire the best for your commercial septic system engineering project in Lutz, FL. Fortunately, our team at Southern Water and Soil is available to provide this service, and many more. [Call today](/contact-southern-water-and-soil/) for a free consultation on commercial septic services or to schedule an appointment with one of our engineers. We are the best in the business, so you won’t regret calling us for all of your commercial septic needs. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), **[Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/)**, [Miami](/commercial-septic-miami-fl/commercial-septic-system-engineering/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), [Florida](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Commercial Septic System Engineering, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/) **Published:** June 7, 2016 **Author:** Southern Water Soil **Content:** ## We will make sure that our commercial septic system engineering works to provide you an efficient and functional system in Land O’ Lakes. ![Commercial Septic System Engineering in Land O’ Lakes, Florida](/wp-content/uploads/2016/06/2011-03-17-17.29.27_resized-300x179.jpg)When you need assistance designing and installing a septic system, you want to know that there’s a company on your side you can rely on. If you have yet to find a septic contractor in **Land O’ Lakes, Florida** that you can trust with your **commercial septic system engineering**, turn to us at Southern Water and Soil. When you work with our highly trained and qualified engineers, there are several things you can count on, including: - **Dependable Service –** Our team will show up at your commercial property on schedule and keep working until we are confident that the job was done right. We will also provide you with regular updates as we work and ensure that you are well informed. - **Expert Design –** We believe that keeping your septic system in good working condition should not cost you a fortune. We will make sure that our commercial septic system engineering works to provide you an efficient and functional system that meets the needs of your community. - **Customized Installation –** Your property’s wastewater disposal needs and your septic system are completely different than those of any other business. For this reason, when we provide you with commercial septic system engineering, we take the time to develop a plan that complements your specific needs. We know you will see the benefits of your new wastewater treatment system when you hire us for **commercial septic system engineering**. We are a full-service company that also provides repair and maintenance services. We will be happy to make recommendations for the best care of your system so it operates its best. Most importantly, as your commercial septic company, we will make sure that your needs are taken care of with excellence. If you’d like to know more about what makes our services stand out from the rest, [get in touch](/contact-southern-water-and-soil/) with us at Southern Water and Soil today. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), **[Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/)**, [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-engineering/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), [Florida](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Commercial Septic System Engineering, Fort Myers, FL](https://southernsepticanddesign.com/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## Get started on the right foot with a well-designed commercial septic system. In certain areas, where connecting to city sewer systems isn’t possible or practical, septic systems are necessary. For businesses, **commercial septic system engineering** is vital to ensure that these systems work efficiently without posing risks to the environment. Here at Southern Water and Soil, we know that a reliable septic system requires a detailed plan and an experienced commercial septic system engineering team, which is what we offer in the **Fort Myers, Florida** region. ![Commercial Septic System Engineering in Fort Myers, Florida](/wp-content/uploads/2024/02/2011-03-17-17.29.12-res.jpg) Businesses produce a lot of wastewater that contains many harmful substances. A well-designed septic system will treat and handle this wastewater before allowing it seep into the environment. This helps keep the earth, groundwater, and nearby bodies of water from getting polluted. Additionally, to protect public health and the environment, there are several rules and regulations about how septic systems should be installed and maintained. Commercial septic system engineering ensures that all these rules, which include design standards, installation requirements, and maintenance requirements, are followed. In terms of capacity and scale, commercial facilities create more wastewater than residential properties. The right commercial septic system engineering plan will consider the needs and size of the business to make sure that the septic system can handle the volume and type of wastewater. Furthermore, commercial septic systems need to be resilient enough to stand strong and structurally sound over time. With experienced commercial septic system engineering behind the design, these factors are considered and implemented for better success. Strong **commercial septic system engineering** is the first step toward effective handling of wastewater for your business. [Contact our team](/contact-southern-water-and-soil/) today to learn more. --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [**Fort Myers**](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-engineering/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/), and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), [Florida](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Commercial Septic System Engineering, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/) **Published:** February 16, 2026 **Author:** Southern Water Soil **Excerpt:** We offer commercial septic system engineering for projects of all sizes, ranging from small schools to large office buildings to strip malls. **Content:** ## Our team has 30 years of combined experience in commercial septic system engineering in the Spring Hill, FL area. ![Commercial Septic System Engineering in Spring Hill, Florida](/wp-content/uploads/2014/07/2011-03-17-17.29.27-e1408945608278-300x178.jpg)At Southern Water & Soil, our team has 30 years of combined experience in commercial septic system engineering. We have completed projects for commercial buildings and companies throughout our service area, which includes **Spring Hill, Florida** and surrounding areas. When we start with your **commercial septic system engineering** project, we will create a customized proposal that includes as many options as you are interested in for your building. After you decide what plan you like, we will start obtaining licenses and permits from the local state department. We offer commercial septic system engineering for projects of all sizes, ranging from small schools to large office buildings to parking structures. When our team creates your proposal and plan, we will work with you to make sure your needs are met. We understand the needs of small business owners, so we make sure every project we plan is reasonable and affordable. We use high-quality equipment for every project we complete, ensuring long-lasting results every time you flush or drain water from your office. We have also designed commercial systems for drip irrigation, which is useful to reduce the footprint of your wastewater system. This allows for more parking spaces, RV Units, mobile homes, or whatever else is desired for your buildout. Our team can build large-scale systems that accommodate very large buildings with multiple drains and toilets on each floor. When we complete your project, the final step is education. We will explain the importance and function of each aspect of the system, so you know what to look for in case there are any potential problems. Please [contact us](/contact-southern-water-and-soil/ "commercial septic systems experts") today with any questions you have about **commercial septic system engineering**. #### Ready to get started? [Fill out a Job Requisition Form](/septic-design-engineering-requisition-for-commercial-customers/) --- *At Southern Water and Soil, we offer **commercial septic system engineering** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-system-engineering/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-engineering/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-engineering/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-engineering/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-engineering/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-engineering/), Orlando, Plant City, Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-system-engineering/)**, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-engineering), [Florida](/commercial-septic-florida/commercial-septic-system-engineering/).* --- ### [Frequently Asked Questions](https://southernsepticanddesign.com/frequently-asked-questions/) **Published:** January 21, 2026 **Author:** Southern Water Soil **Content:** ## Everything you need to know about our septic services in one convenient place. At Southern Water and Soil, we understand that septic systems can raise a lot of questions, whether you’ve lived on a property with one for years or are looking to install one on your newly purchased lot. Below, you’ll find straightforward answers to some of the most common questions our team receives about septic systems, our services, maintenance, care, and more. If the information you’re looking for isn’t included below, please don’t hesitate to reach out to us for the answers you need! ##### Hidden ##### What services does your team offer? We are proud to be a full-service septic company. We specialize in designing, engineering, and installing [septic systems](/residential-septic-services-dade-city-fl/septic-systems/) for residential and commercial properties, and our list of services also includes maintenance, pumping, [drain field repair](/residential-septic-services-dade-city-fl/drain-fields/drain-field-repair/) and replacement, lift station maintenance, real estate septic inspections, and commercial wastewater management. ##### What are your business hours? We are available for standard services Monday through Friday from 8:00 AM to 5:00 PM. We also offer emergency [septic services](/septic-services-dade-city-fl/) for residential customers. ##### How do I schedule a service appointment or get a quote? You can contact our office directly by calling (833) 543-6374, or you can fill out our online [contact form](/contact-southern-water-and-soil/). Our team will quickly respond to your inquiry to discuss your project or service needs. ##### Is your company licensed and insured? Yes, we are fully licensed and insured. Additionally, our team includes Master Septic Contractors and certified environmental health professionals, which helps us ensure all work is completed in alignment with strict Florida codes and regulations. ##### Do you offer services for homes and businesses? Yes, we are proud to provide services for residential and commercial properties. Our team can handle everything from minor home septic repairs to complete commercial system design and installation. ##### How experienced is your team? We bring over 30 years of combined experience in the septic industry. ##### Why should I choose your company to handle my septic needs? We’re more than just a [septic pumping company](/residential-septic-services-dade-city-fl/septic-pumping-services/septic-pumping-companies/) — we’re septic system diagnostic and design specialists. We find the root cause of failures and deliver reliable solutions that protect your property and the surrounding environment. Our engineering expertise allows us to design septic systems that many other septic companies would find to be too technically sophisticated for their skill level. ##### Will you assist with permitting and other logistics? Yes, we are experts at navigating the often complex permitting process, and we’re also here to assist with [BMAP](/nitrogen-reducing-septic-system-dade-city-fl/basin-management-action-plan/) (Basin Management Action Plan) requirements so that you can ensure compliance with nitrogen-reduction mandates. ##### What happens during the design and engineering process? Our team will carefully inspect your property, including the soil conditions, water table, and expected usage. We use that information to create a custom blueprint for your septic system, which ensures it is properly sized and positioned to meet all the requirements set forth by the Florida Department of Health. This also ensures optimal functionality for as long as possible. ##### Do you offer nitrogen-reducing or performance-based septic systems? Yes, we can work with you to design and install Advanced Secondary Treatment systems, which include Passive Nitrogen and [Performance-Based Septic Systems](/residential-septic-services-dade-city-fl/septic-engineering/performance-based-septic-systems/) (PBSS). These are often a requirement for properties in environmentally sensitive areas, such as near springs or protected bodies of water. ##### Can you assist with a septic-to-sewer conversion? Yes, our team is more than equipped to engineer and manage a [septic-to-sewer conversion](/residential-septic-services-dade-city-fl/septic-to-sewer-commercial-corridors-program/septic-to-sewer-conversion/), helping property owners transition from a septic system to a municipal sewer line. We take great care to ensure the old tank and other system elements are properly abandoned and permitted. ##### How often do I need to pump my septic tank? The general guideline for most residential homes is to pump the tank every 3–5 years. However, the best schedule will depend on factors like your household size, tank size, water use patterns, and other logistics. The only way to get a precise pumping schedule is to have a trained technician come assess your system and make a recommendation. This is especially true for commercial systems. ##### Are there signs that indicate a failing drain field? Yes. Common warning signs include slow-draining toilets, gurgling sounds in the pipes, wet or oddly green patches of grass over the tank or [drain field](/residential-septic-services-dade-city-fl/drain-fields/), and sewage odors around the yard. If you spot any of these signs, [contact us](/contact-southern-water-and-soil/) immediately for an inspection. ##### Is it possible to repair a damaged drain field? In some cases, but it will depend on the extent of the damage. Our team specializes in drain field repair and can often save a system if the issue is caught early enough. This is why we stress the importance of routine maintenance to our customers. ##### What is a lift station, and will I need one? [Lift stations](/residential-septic-services-dade-city-fl/lift-stations/) are accessory components of a septic system that are implemented when your plumbing is at a lower elevation than your septic tank and/or drain field. They use a pump to move the waste “uphill” in cases where gravity cannot accomplish the transition. Our team provides lift station installation, repair, and replacement for residential and commercial properties. ##### Do you provide septic inspections for real estate transactions? Yes, we offer comprehensive [Real Estate Sale Septic Inspections](/septic-inspections-dade-city-fl/septic-system-inspections/real-estate-sale-septic-inspections/). Our Master Septic Contractors perform a detailed evaluation that ensures the buyer or seller knows the true conditions of the septic system prior to a sale. ##### What is included with a commercial septic inspection? Commercial inspections typically include checking the tank integrity, baffles, grease traps, lift stations, and drain field performance to ensure the system can meet the high demands of commercial use. ##### Do you offer maintenance for aerobic septic systems? Yes. Aerobic systems require more frequent maintenance than traditional systems because they have more mechanical parts and rely on oxygen to treat waste. Our team provides specialized maintenance for these systems to ensure they are operating correctly. ##### Will your team be handling my residential septic installation/replacement? For residential [septic system installations](/residential-septic-services-dade-city-fl/septic-systems/septic-system-installations/) or replacements, we handle all the permitting, design, engineering, and considerations for BMAP planning. However, the actual installation will be handled by one of our carefully vetted partners. ##### What is a “package plant,” and does your team install them? A package plant is a pre-manufactured treatment system that can be used for small communities or commercial developments. Our team has decades of experience handling [package plant installations](/package-plant-installations-dade-city-fl/) in the area and is happy to assist you with the process. ##### Do you offer construction management for wastewater projects? Yes, we provide end-to-end [wastewater project management](/construction-management-dade-city-fl/wastewater-project-management/), including the initial site evaluation, engineering and design, permitting, contractor oversight, and final system commissioning. ##### What kinds of clients do you typically manage projects for? Our [construction management](/construction-management-dade-city-fl/) services are designed for developers, general contractors, commercial property owners, and municipalities. Our team specializes in handling projects that require complex engineering, including housing developments, RV parks, and commercial retail centers. ##### Can you assist with navigating BMAP and nitrogen-reduction requirements? Yes, helping clients navigate BMAP is a core part of what we do. Our team will ensure your development meets all local and state environmental mandates, helping you avoid costly fines and construction halts. ##### Do you consult on existing wastewater infrastructure? Yes, we offer diagnostic and consulting services for existing systems that are failing or need to be expanded. Our team will manage the retrofit or upgrade process to ensure older systems meet modern code requirements. --- ### [Construction Management, Dade City, FL](https://southernsepticanddesign.com/construction-management-dade-city-fl/) **Published:** October 31, 2025 **Author:** Southern Water Soil **Content:** ## Ensure the efficiency and effectiveness of your wastewater construction project. At Southern Water and Soil, we offer professional oversight and coordination as part of our **construction management** services, ensuring every wastewater infrastructure project we take on is completed within budget, on schedule, and with efficiency. During all phases of planning, design, and construction of the physical elements, including pump stations, treatment tanks, mechanical equipment, and control buildings, we apply proven construction management techniques to ensure success. ![Construction Management in Dade City, Florida](/wp-content/uploads/2025/10/iStock-1279961144-res.jpg) We act as a central point of coordination between contractors, suppliers, and owners, streamlining communication and ensuring all phases of the project move forward smoothly. We focus on proactive scheduling, accurate cost estimation, and clear progress tracking to prevent delays and cost overruns. From procurement of supplies to managing contractors and quality control, we provide the accountability and structure required to ensure a successful wastewater build. Every project we manage in the **Dade City, Florida** area complies with strict standards for reliability and performance, and all applicable environmental and regulatory requirements are followed, all without sacrificing for efficiency. We identify and resolve potential issues early on, maintain detailed documentation, and keep all stakeholders fully informed throughout the construction process. Our construction management services combine our technical expertise, field experience, and strong organization skills to help developers, municipalities, and HOAs achieve dependable wastewater systems. For a wastewater management solution that is built right, built efficiently, and built to last, turn to us. [Contact us today](/contact-southern-water-and-soil/) for more information about our **construction management** services. --- *At Southern Water and Soil, we offer **construction management** services in Brooksville, [**Dade City**](/construction-management-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* ### Similar Services We Offer: --- ### [Wastewater Project Management, Dade City, FL](https://southernsepticanddesign.com/construction-management-dade-city-fl/wastewater-project-management/) **Published:** October 31, 2025 **Author:** Southern Water Soil **Content:** ## We offer complete wastewater project management solutions. At Southern Water and Soil, providing complete **wastewater project management** services to support municipalities, HOAs, and developers is one of our specialties. We bring new land opportunities to life with efficiency using new treatment technologies and system designs. With our wastewater project management solutions, properties that were once viewed as unsuitable for development can now support thriving residential and commercial communities. ![Wastewater Project Management in Dade City, Florida](/wp-content/uploads/2025/10/iStock-1450419337-res.jpg) We manage every aspect of the wastewater projects we take on, from planning and designing to permitting, construction, and final system commissioning. We coordinate with regulatory agencies, engineers, and contractors to ensure every project stays on schedule, within budget, and compliant with all state and local requirements. We take a proactive approach to quality assurance, cost control, and scheduling, eliminating obstacles that often limit wastewater projects here in **Dade City, Florida**. For developers, our wastewater project management capabilities mean more buildable lots and a greater return on investment. For municipalities, it means the ability to meet housing demand and successfully expand infrastructure. And for HOAs, these capabilities open up options for expanding and upgrading community systems without complete disruption. We incorporate SCADA monitoring and automation solutions whenever possible. These solutions ensure long-term performance, remote oversight, and simplified maintenance after construction is complete. When wastewater challenges are making the completion of your development project difficult, we offer the management expertise and technical innovation to get things moving. Learn more about our **wastewater project management** options and solutions by [reaching out to us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **wastewater project management** services in Brooksville, [**Dade City**](/construction-management-dade-city-fl/wastewater-project-management/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Partners](https://southernsepticanddesign.com/partners/) **Published:** September 7, 2016 **Author:** Southern Water Soil **Content:** ## We have partnered with many companies in the septic industry. At Southern Water and Soil, we take pride in our quality septic services, and one of the reasons why so many prefer our septic design and engineering services here in Florida is because of our partners and suppliers. On this page, you can find the suppliers we work with when doing projects, as well as our septic partners, who help us complete projects from beginning to end. Our goal is to make your septic project as streamlined as possible, and we make this happen by working with partners who can deliver their expertise. To learn more about our partners, contact us today. **Distributed Wastewater** ![distributed wastewater](/wp-content/uploads/2025/10/Distributed-Wastewater-300-res1-150x150.jpg)If you are a developer or municipality seeking flexible wastewater solutions for future projects in the state of Florida, our sister company, Distributed Wastewater, can assist. They specialize in decentralized and distributed systems to provide more comprehensive development possibilities while optimizing for environmental compliance and wastewater monitoring. **Southern Water Distribution** ![southern water distribution](/wp-content/uploads/2025/10/Southern-Water-Distribution-72-res1-150x150.jpg)Southern Water Distribution supplies the septic industry throughout the state of Florida from our Land O’Lakes, Florida distribution center. We provide end-to-end parts, pieces and components for both residential and commercial septic projects. Regardless of the size or scope of your project, we’re here to offer advice alongside a complete septic distribution service. **Orenco** ![2016-09-07_1410](/wp-content/uploads/2016/09/2016-09-07_1410-150x150.jpg)Orenco has designed and sold effective, sustainable wastewater treatment systems since 1981. We use their award-winning technologies during the design and installation of many of the septic projects we are presented with, including the Orenco Advantex AX-MAX. This system’s proven media filter technology makes it ideal for small to mid-size communities that want to enjoy a cost-effective, simple way to manage wastewater treatment. **Norweco** ![norweco_header_1_1](/wp-content/uploads/2016/09/norweco_header_1_1-150x150.jpg)A manufacturer of wastewater treatment chemicals, products, and systems, Norweco specializes in small-flow treatment applications that are a good fit for municipalities to the single family home. Originally founded in 1906, Norweco’s tradition for producing exceptional products is one of the main reasons why we are proud to have them as a partner. **Geoflow** ![2016-09-07_1408](/wp-content/uploads/2016/09/2016-09-07_1408-150x150.jpg)Geoflow produces wastewater products and technologies that are designed to preserve the quantity and quality of valuable water resources. We regularly recommend Geoflow’s subsurface drip systems because they can solve many of the common issues that plague the wastewater dispersal process. Ideal for residential, commercial, industrial, and municipal applications, these systems eliminate the cost of continual effluent treatment. **Clearstream** ![newlogo2_r1_c1](/wp-content/uploads/2016/09/newlogo2_r1_c1-150x150.jpg)When a client is looking for a highly efficient, extended aeration sewage treatment plan, we recommend the Clearstream Water Treatment System. Many alternative methods of wastewater disposal are made possible with this system due to the high quality of the effluent discharged from it. Thanks to its simplicity, reliability, and excellent construction, we continually implement this system during septic projects. **PTI, Inc.** ![2016-09-07_1409](/wp-content/uploads/2016/09/2016-09-07_1409-150x150.jpg)A family-owned business that holds many of the same values as we do, Plastic Tubing Industries, Inc. has manufactured high-density polyethylene plastic pipe since 1969. Their piping is excellent for the construction of drain fields, and we use it consistently when we manage new septic installations. **Tuf-Tite** ![1c91cbb905bbfa0de00b950ccde1ec9c_resized](/wp-content/uploads/2016/09/1c91cbb905bbfa0de00b950ccde1ec9c_resized-150x150.jpg)A manufacturer of patented drainage and septic products, Tuf-Tite has been contributing to the septic industry since 1984. We value their expertise, as well as the exceptional products they produce because their manufacturing processes are based on years of field testing and polymer formulation experience. **Infiltrator Water Technologies** ![infiltrator-water](/wp-content/uploads/2016/09/infiltrator-water-150x150.jpg)Products from Infiltrator Water Technologies offer many different benefits, such as cost savings, less site disruption, superior technology, and ease of installation. With over 3 million Infiltrator Water Technologies systems installed throughout the world, we are proud to be a part of this movement. --- ### [Distributed Wastewater Treatment Unit Permits, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/distributed-wastewater-treatment-units/distributed-wastewater-treatment-unit-permits/) **Published:** July 8, 2025 **Author:** Southern Water Soil **Content:** ## We can handle permitting for your distributed wastewater treatment unit. Securing distributed wastewater treatment unit permits can feel like navigating a never-ending maze. At Southern Water and Soil, we make acquiring distributed wastewater treatment unit permits a simple, efficient, and stress-free process. Our team, which possesses a deep understanding of local codes here in **Dade City, Florida**, handles every step, so you never have to face permit headaches again. ![Distributed Wastewater Treatment Unit Permits in Dade City, Florida](/wp-content/uploads/2025/07/20220303_154759-res.jpg) We follow a general process when obtaining **distributed wastewater treatment unit permits**: - We will start by evaluating your site and wastewater needs. Our septic professionals will assess the soil, site condition, and projected flows to determine exactly what permit documentation is required. Whether you are installing an advanced alternative system or an aerobic treatment unit, we know exactly which forms, reports, and studies local organizations mandate. - We will then prepare a comprehensive permit application package customized to your jurisdiction, whether it is a state regulatory agency or a county environmental health office. We will include flow calculations, engineered design plans, and other necessary information in this package. We will double-check all documentation for completeness, consistency, and compliance to reduce the risk of delays or rejection. - Once submitted, we will promptly address any technical questions, engineering clarifications, or revision requests, guiding your project quickly toward approval. Our team is committed to ensuring timelines are met and expectations exceeded. We are here to guide your septic project through permitting with confidence and clarity. [Reach out to us today](/contact-southern-water-and-soil/) to learn more about our process for securing **distributed wastewater treatment unit permits**. --- *At Southern Water and Soil, we handle the entire process for acquiring **distributed wastewater treatment unit permits** in Brooksville, **[Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-units/distributed-wastewater-treatment-unit-permits/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Distributed Wastewater Treatment System Designs, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/distributed-wastewater-treatment-unit-designs/distributed-wastewater-treatment-system-designs/) **Published:** July 8, 2025 **Author:** Southern Water Soil **Content:** ## We can design your distributed wastewater treatment system. At Southern Water and Soil, we specialize in a variety of septic services, including providing **distributed wastewater treatment system designs** to our valued clients. These types of systems offer reliable, proven wastewater treatment for properties that are not connected to a centralized sewer system. They are also ideal for many types of properties throughout the **Dade City, Florida** area, including rural communities, commercial sites, residential developments, and other locations where traditional sewer infrastructure is impractical or unavailable. ![Distributed Wastewater Treatment System Designs in Dade City, Florida](/wp-content/uploads/2025/07/20150214_090751-res.jpg) Distributed wastewater systems treat wastewater at or near the source, reducing the need for extensive piping and costly treatment plants. When you partner with us, our team will work closely with all involved property owners, developers, and engineers to design custom systems that meet the needs of that specific site, in addition to complying with state and local regulations. We offer a wide range of options for **distributed wastewater treatment system designs**, including those with septic tanks that have advanced treatment units. We will consider the topography, soil conditions, and projected usage of your property during the design phase. Our expert designs ensure efficient wastewater management while minimizing energy use and long-term maintenance requirements. With over 20 years of industry experience, we know that every project is unique. From the initial site evaluation to the final design, we will provide full-service support to make sure your system is built to last. [Contact us today](/contact-southern-water-and-soil/) to schedule a consultation to discuss our distributed wastewater treatment system designs and to discover how we can help you manage wastewater with smart, scalable solutions. --- *At Southern Water and Soil, we offer **distributed wastewater treatment system designs** in Brooksville, **[Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-unit-designs/distributed-wastewater-treatment-system-designs/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Certified Environmental Health Professional, Dade City, FL](https://southernsepticanddesign.com/master-septic-contractor-dade-city-fl/certified-environmental-health-professional/) **Published:** May 21, 2025 **Author:** Southern Water Soil **Content:** ## Our company’s founder is proud to be a certified environmental health professional. Here in **Dade City, Florida**, anyone who works in Onsite Sewage Treatment and Disposal Systems (OSTDS) is required to be a **certified environmental health professional**. Earning this important credential shows property owners that the septic professional knows how to safely maintain, repair, install, and replace different components within septic systems without posing environmental risks or exposing people to potential health hazards. As a locally owned and operated business, our team at Southern Water and Soil takes this role incredibly seriously, and we are proud to have a certified environmental health professional at the head of our company. ![Certified Environmental Health Professional in Dade City, Florida](/wp-content/uploads/2025/05/2013-07-10-14.34.05-res.jpg) To us, being a certified environmental health professional is about so much more than just meeting local regulations. Ever since we launched our septic business, we have been deeply committed to providing the best possible solutions for every customer we work with, and this all begins with caring for the environment. Each member of our team is familiar with the best practices for designing, building, and maintaining functional septic systems that prevent environmental damage and keep our communities safe and sound. It’s also important to note that becoming a certified environmental health professional isn’t as simple as submitting a form. These certifications expire every 2 years, and to maintain their certifications, professionals must complete at least 24 hours of ongoing training or education in their chosen field. For instance, each **certified environmental health professional** on our team works hard to stay updated on the latest developments in the septic industry to ensure that we can offer top-notch solutions for our clients. If you’d like to learn more about our credentials and experience, feel free to [connect with us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, our **certified environmental health professionals** serve Brooksville, [**Dade City**](/master-septic-contractor-dade-city-fl/certified-environmental-health-professional/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Aerobic Septic Systems, Florida](https://southernsepticanddesign.com/commercial-septic-florida/aerobic-septic-systems/) **Published:** March 20, 2024 **Author:** Southern Water Soil **Content:** ## Don’t settle for an outdated, high-maintenance septic system. Outdated septic systems can be smelly, messy, and harmful to the environment. At Southern Water and Soil, we specialize in aerobic septic systems, an innovative, sustainable wastewater treatment option for **Florida** homes and businesses. ![Aerobic Septic Systems in Florida](/wp-content/uploads/2023/12/2012-11-20-12.45.25-res.jpg) Aerobic systems utilize oxygen and aerobic bacteria to break down waste and effluent on your property. This occurs in a treatment tank through a process called aerobic digestion. Air is injected into the tank, allowing helpful bacteria to thrive and treat sewage cleanly and efficiently. Unlike traditional septic tanks, the result is an environmentally sound solution that does not rely on chemicals, threaten groundwater, or emit greenhouse gases. **Aerobic septic systems** also eliminate the foul odors and soggy lawns from failed drain fields. Aerobic digestion significantly reduces harmful bacteria, nutrients, and pathogens compared to conventional septic tanks. The treated liquid can be safely reintroduced into the environment, and with proper maintenance, an aerobic system’s lifespan is often longer than that of other options. **Aerobic septic systems** conserve water and energy while keeping groundwater supplies pathogen- and nitrate-free. We handle all permitting and installation aspects of aerobic septic systems. Our certified team designs and installs effective treatment systems sized for your specific household and soil conditions. Proper maintenance is key to longevity and performance, and if your system needs repairs, we quickly diagnose and fix any issues with minimal inconvenience to keep your system running optimally. You can feel good knowing your waste products are being treated responsibly with us because we’re locally owned wastewater management experts who have served the area for over 30 years. Don’t settle for an outdated, high-maintenance septic system. [Reach out today](/contact-southern-water-and-soil/) to learn more or schedule a custom consultation. --- *At Southern Water and Soil, we install **aerobic septic systems** in Brooksville, [Dade City](/commercial-septic-dade-city-fl/aerobic-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, **[Florida](/commercial-septic-florida/aerobic-septic-systems/)**.* --- ### [Aerobic Septic Systems, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/aerobic-septic-systems/) **Published:** May 21, 2025 **Author:** Southern Water Soil **Content:** ## Our dedicated team can install, repair, and maintain aerobic septic systems here in Dade City. In our many years of experience here at Southern Water and Soil, our team has seen **aerobic septic systems** become more and more commonplace throughout the **Dade City, Florida** region. Aerobic septic systems have a couple key advantages compared to traditional septic systems, and our knowledgeable crew is fully equipped to help you determine which option is right for your unique property. If you’re looking for a team that can repair, install, or replace aerobic septic systems, you’ve come to the right place! ![Aerobic Septic Systems in Dade City, Florida](/wp-content/uploads/2023/12/2012-11-20-12.45.25-res.jpg) The key difference between aerobic septic systems and standard septic systems lies in the way that the wastewater is treated after the solids are filtered out. With aerobic septic systems, the wastewater is exposed to aerobic bacteria, which digests the biological materials. Standard septic systems include other filtration methods to treat wastewater, but they require larger drain fields and don’t produce the same high-quality effluent that aerobic septic systems develop. Aerobic septic systems can sterilize and recycle wastewater more efficiently, making them ideal for a wide variety of residential and commercial properties alike. If you decide to contact our team to learn more about **aerobic septic systems**, we’ll promptly help you schedule a consultation with one of our professionals. We’ll fully answer any questions you may have, inspect your property, and give you more tailored advice and recommendations based on your unique situation. If you need us to inspect an aerobic system, we can do so and apply any necessary repairs as well. To get started, please [reach out to our office today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **aerobic septic systems** in Brooksville, [**Dade City**](/commercial-septic-dade-city-fl/aerobic-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/commercial-septic-florida/aerobic-septic-systems/).* --- ### [Commercial Septic Inspection Intake](https://southernsepticanddesign.com/commercial-septic-inspection-intake/) **Published:** March 14, 2025 **Author:** Southern Water Soil **Content:** ## Please fill in all fields. We’ll get back to you within 2-3 business days. "\*" indicates required fields Δ Name\* Company\* Job Title\* Address of required design\* Email\* Phone\* Do you have an approved permit?\* Yes No Are there any previous inspections?\* Yes No Anything else that we need to know? --- ### [Commercial Real Estate Septic Inspections, Dade City, FL](https://southernsepticanddesign.com/septic-inspections-dade-city-fl/septic-system-inspections/commercial-real-estate-septic-inspections/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## We recommend buyers, sellers, and others consider commercial real estate septic inspections. At Southern Water and Soil, we are proud to be a highly regarded commercial septic services provider serving the **Dade City, Florida** area. While the vast majority of our customers call us for commercial maintenance, repairs, installations, and replacements, we want you to know that we are also here for you when it comes time to purchase or sell a property that has a septic system. Our **commercial real estate septic inspections** are an important part of any commercial real estate transaction, so you can have peace of mind that you have all the pertinent facts about the age and condition of the septic system. ![Commercial Real Estate Septic Inspections in Dade City, Florida](/wp-content/uploads/2020/07/2011-08-01-16.05.20-1.jpg) As a seller, you would prefer not to have any surprises come up during the due diligence period that could sour your buyer’s interest. **Commercial real estate septic inspections** can be a strong selling point, as well, as it shows your dedication to taking care of the property and selling it with a clean bill of health, so to speak. As a buyer, if the seller has not provided you with a recent inspection report, you should call us to learn about commercial real estate septic inspections. You will likely have a general inspector look over the property and while that is a great idea, they won’t be as thorough with the septic system inspection as we will be. It is far better to learn of a problem before you close when you are in the position of renegotiating if it requires major repairs or replacement. Even if you are neither a buyer nor a seller, commercial real estate septic inspections are important. We can catch problems when they are more affordable to resolve rather than wait for a major failure and backup that could halt your business operations. [Call today](/contact-southern-water-and-soil/) to schedule an appointment for an inspection and have peace of mind that all is well. #### Ready to get started? [Fill out a Job Requisition](/commercial-septic-inspection-intake/) --- *At Southern Water and Soil, we perform **commercial real estate septic inspections** in Brooksville, [**Dade City**](/septic-services-dade-city-fl/commercial-real-estate-septic-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, [Orlando](/septic-services-orlando-fl/commercial-real-estate-septic-inspections/), Plant City, Spring Hill, and [Tampa](/septic-services-tampa-fl/commercial-real-estate-septic-inspections/), Florida.* --- ### [Commercial Septic Design Engineering Intake](https://southernsepticanddesign.com/commercial-septic-design-engineering-intake/) **Published:** March 12, 2025 **Author:** Southern Water Soil **Content:** ## Please fill in all fields. Required fields are indicated with \*. We’ll get back to you within 2-3 business days. "\*" indicates required fields Δ Name\* Company\* Job Title\* Address of required design\* Email\* Phone\* Do you have a permit?\* Yes No Do you need a PPI?\* Yes No Anything else that we need to know? --- ### [Commercial Septic System Design, Florida](https://southernsepticanddesign.com/commercial-septic-florida/commercial-septic-system-design/) **Published:** June 27, 2023 **Author:** Southern Water Soil **Content:** ## We design fully functional septic systems for commercial properties. ![Commercial Septic System Design in Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2016/10/Please-make-sure-to-include-this-one-2012-01-18-13.38.23-resized1.jpg?lossy=1&strip=0&webp=1)Commercial septic systems are much more complex than residential ones. They must also deal with a larger volume of wastewater on a daily basis, which impacts their basic design and structure. For most commercial properties, careful and diligent **commercial septic system design** is needed to ensure the functionality and longevity of the new septic system. At Southern Water and Soil, our commercial septic system design team can help you plan and lay out your septic system according to the requirements of your facility and the requirements of your particular building site. We have designed septic systems for many businesses and operations throughout **Florida**, including for schools, shopping centers, hospitals, and other similar establishments. There are many factors we will take into account when designing your septic system. For example, we will assess the expected wastewater flow rate, the size of the establishment, the number of occupants, and local regulations and codes. We will also consider the site’s topography and soil. The commercial septic system design process may involve conducting a wastewater analysis, sizing the tank, designing the drain field, identifying the best possible pumping systems, and ensuring the design meets local and state regulations for wastewater disposal. We have over 30 years of experience with commercial septic system design, and we are here to exceed your expectations. For more information about our **commercial septic system design** process, [get in touch with us today](/contact-southern-water-and-soil/). ### Contact Southern Water and Soil Today! [Contact Us](#) ### FAQs About Commercial Septic System Design Having safe and reliable waste management is extremely important for any commercial property. We understand that builders and developers of commercial and industrial properties have unique septic needs, and we are here to meet them through commercial septic system design. Check out our frequently asked questions below or contact our company to learn more about what to expect when you hire our team for commercial septic system design. ##### Hidden ##### Do you design low nitrogen septic systems? Yes, low nitrogen [septic system engineering](/commercial-septic-florida/commercial-septic-system-engineering/) is one of our specialties, so you can certainly rely on us to design your system. We carefully survey your property and account for its unique features as we design your system and provide systems that will pass inspection (and allow you to scale your development accordingly). Not only do we follow state and local regulations to ensure your septic system won’t be a major contributor to watershed contamination, but we offer solutions for monitoring the system in order to meet compliance requirements. ##### Do you handle septic system permitting and inspections? As Certified Master Septic Contractors, we’re licensed by the state of Florida to perform septic system permitting at the outset of a septic or wastewater project and perform inspections when the project is complete. This can be done as part of our septic design and/or engineering services, or as a stand-alone if you are working with another septic system installer. ##### Why should I trust your company for commercial septic system design? Not only do we have three decades of combined experience and the credentials to meet your commercial septic system design needs, but we also offer comprehensive permitting, engineering, inspection, and installation services. Our motto is to do the work right the first time, and that applies to our septic design offerings as well. We also offer cutting-edge septic system and wastewater components and supplies through our sister company, Southern Water Distribution. Regardless of who you work with for installation, we can provide you with a tip-to-tail list of all required parts and pieces in order to complete the job (and even deliver the supplies right to your job site). ### Contact Southern Water and Soil Today! [Contact Us](#) *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [D](/commercial-septic-brandon/commercial-septic-design/)[ade](/commercial-septic-brandon/commercial-septic-design/)[ City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [**Florida**](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Residential Septic, Florida](https://southernsepticanddesign.com/residential-septic-florida/) **Published:** June 27, 2023 **Author:** Southern Water Soil **Content:** ## Let us help with all your residential septic needs. You rely on your septic system every single day to properly dispose of wastewater from your home. While you may not pay attention to what happens with your septic system all the time, you appreciate that it works in the background to keep wastewater moving through your home and out into your drain field. ![Residential Septic in Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/03/septicsystemwarrantypackagesres.jpg?lossy=1&strip=0&webp=1) If your home in **Florida** has a septic system, you need a **residential septic** system company on your side to provide general maintenance, repairs, and guidance, especially when something goes wrong. At Southern Water and Soil, we’re best known for our commercial septic services, but we also work with carefully selected partners to provide residential septic services you can trust. We have over 30 years of experience in the septic industry, and we’ll exceed your expectations with our service, workmanship, and advice. What kind of residential services do we offer? When it comes to **residential septic** services, we do it all. We can pump out your septic system, help you plan for the installation of a new one, inspect your septic system, fix your drain field, fix your septic tank, and much, much more. No septic job is too large or too small for our team to handle, and we’re here to make sure your system continues to run with optimal functionality and efficiency. When it comes to choosing a septic system services provider, you can’t go wrong with choosing our team. [Contact us today](/contact-southern-water-and-soil/) to learn more about our septic services and to set up your next appointment. ### Contact Southern Water and Soil Today! [Contact Us](#) ### FAQs About Residential Septic Services With more than three decades of experience, we have had the opportunity to provide a variety of residential septic services over the years. We’re highly familiar with Florida residents’ septic needs, the rules that must be followed, and the concerns that customers tend to have, so you can place your trust in us. Check out our frequently asked questions about residential septic services below. ##### Hidden ##### Do you provide septic system permitting and inspections for homeowners and/or builders? Yes, as Certified Master Septic Contractors, we are licensed by the state to complete [inspections](/septic-inspections-dade-city-fl/) and can assist with permitting during the planning phase. ##### Do you offer low nitrogen septic system engineering? Yes, this is one of our specialties. As leaders in the industry for decades, we can help explain the system requirements for your property and provide various options. We can simply engineer the system if you’d like. Our sister company, Southern Water Distribution, can provide a detailed parts list and deliver all the required parts and pieces to complete the work. ##### Does my septic system need to be updated in order to pass inspection? Depending on the age of the current septic system you’re replacing, chances are that your system will need to be brought up to code. This is typically identified during the permitting process. If your property has been identified as needing to comply with BMAP rules, specific upgrades will be required (or the property may be required to move from a septic system to a sewer system). We know that navigating these particulars can be tricky, so we offer help to navigate the process. We can also help explain the options that your residential property may have available. ##### What is a septic to sewer conversion? Specific regions throughout Florida have been identified as the priority to move away from septic systems (where nitrogen is polluting the groundwater, fresh water, or ocean) and over to a managed sewer program. With specific properties converting to public sewer systems, there will be a significant reduction in the risk of groundwater contamination. Septic to sewer conversions also help to divert the potential for individual septic system failures. ### Contact Southern Water and Soil Today! [Contact Us](#) *At Southern Water and Soil, we offer **residential septic services** in [Brooksville](/residential-septic-brooksville-fl/), [Dade City](/residential-septic-services-dade-city-fl/), [Fort Myers](/residential-septic-fort-myers-fl/), Land O’ Lakes, Lutz, [Miami](/residential-septic-miami-fl/), [Odessa](/residential-septic-odessa-fl/), Orlando, Plant City, [Spring Hill](/residential-septic-spring-hill-fl/), and [Tampa](/residential-septic-tampa-fl/), **[Florida](/residential-septic-florida/)**.* ### Similar Services We Offer: --- ### [Real Estate Sale Septic Inspections, Brooksville, FL](https://southernsepticanddesign.com/septic-inspections-brooksville-fl/septic-system-inspections/real-estate-sale-septic-inspections/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## It’s essential to ensure the septic system is in good working order, whether you’re selling, buying, or the agent in charge. When purchasing or selling a home, there are several inspections and assessments performed to ensure that the property is in good condition and fulfills regulatory requirements. However, the septic system might not always make the list. While not as flashy as a kitchen renovation or a new roof, the septic system’s condition can have a big impact on both buyers and sellers in a real estate transaction. This is why you need a qualified and experienced team who can complete **real estate sale septic inspections** on your side. ![Real Estate Sale Septic Inspections in Brooksville, Florida](/wp-content/uploads/2020/02/2011-03-17-17.29.12_resize.jpg) First, it’s important to understand the purpose of septic systems. These underground wastewater treatment systems are essential for managing domestic wastewater, separating particles from liquids, and letting treated water soak into the soil. Ultimately, real estate sale septic inspections offer financial protection. A thorough septic assessment can help buyers avoid pricey surprises after they purchase a property, as repairing or replacing a malfunctioning septic system might cost thousands of dollars. Knowing the condition of the system upfront allows them to budget for future things that need to be maintained or fixed rather than being hit with the cost right away. For sellers, it means they can ask top dollar for their properties and have the peace of mind that the septic system is in good condition. During **real estate sale septic inspections**, we assess the tank’s condition, look for leaks or signs of wear, inspect the drainage field, and evaluate its overall functionality. We can also look for any blockages or malfunctions that could impair the system’s performance. Once we’re finished, we provide detailed information to the party requesting the inspection and answer any questions they may have. Whether you’re buying or selling—or you’re the agent in charge of the listing—having the septic system inspected is a vital piece of the puzzle in the **Brooksville, Florida** area. [Contact our team](/contact-southern-water-and-soil/) at Southern Water and Soil to learn more. --- *At Southern Water and Soil, we perform **real estate sale septic inspections** in [**Brooksville**](/septic-inspections-brooksville-fl/septic-system-inspections/real-estate-sale-septic-inspections/), [Dade City](/septic-inspections-dade-city-fl/septic-system-inspections/real-estate-sale-septic-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Real Estate Sale Septic Inspections, Dade City, FL](https://southernsepticanddesign.com/septic-inspections-dade-city-fl/septic-system-inspections/real-estate-sale-septic-inspections/) **Published:** December 17, 2024 **Author:** Southern Water Soil **Content:** ## We can inspect your septic system before selling your home. **Real estate sale septic inspections** are a type of inspection performed on the septic system of a property that is being bought or sold. This type of inspection is critical for properties that rely on a septic system for wastewater treatment, especially in rural or suburban areas where municipal sewage systems are not available. ![Real Estate Sale Septic Inspections in Dade City, Florida](/wp-content/uploads/2020/02/2011-03-17-17.29.12_resize.jpg) At Southern Water and Soil, we conduct real estate sale septic inspections throughout the **Dade City, Florida** area. When we perform these inspections, there are a few things we check: - We will check the septic tank to ensure it is functioning properly, is not leaking, and has enough capacity for the size of the household. We will also evaluate the tank for signs of corrosion or damage. - We will inspect the drain field for signs of failure, such as wet spots, foul odors, and other signs that wastewater is not being properly filtered and dispersed into the soil. - We will check the pipes leading from the house to the septic system, looking for leaks and blockages. At the conclusion of our **real estate sale septic inspections**, we provide a report detailing the condition of the system, including any recommended repairs or replacements. If the system is found to be in poor condition, or it fails the inspection, this can be used during the negotiation process. If you are selling or buying property, having a septic system inspection performed is essential. For more information about our inspections or to schedule an inspection time, [contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we perform **real estate sale septic inspections** in [Brooksville](/septic-inspections-brooksville-fl/septic-system-inspections/real-estate-sale-septic-inspections/), [**Dade City**](/septic-inspections-dade-city-fl/septic-system-inspections/real-estate-sale-septic-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, Florida.* --- ### [Commercial Septic System Design, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-system-design/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Excerpt:** We can make sure your new commercial septic system is the correct size to accommodate the amount of waste that will travel through the plumbing in your building. **Content:** ## If you have any questions or would like to talk about options for commercial septic system design in Tampa, FL, call our experts today. ![commercial septic system design](/wp-content/uploads/2014/07/2012-01-18-13.38.23-300x179.jpg)At Southern Water & Soil, we have engineers who can assist with commercial septic system design in **Tampa, Florida** and surrounding areas. One aspect of **commercial septic system design** that can benefit your property is adding lift station pumps, since these ensure that waste and water flow to the tank and out into the drain field. We install aerobic treatment units, advanced treatment systems, performance based treatment systems, and secondary treatment systems. We also engineer low-pressure dosing systems, drip irrigation systems, and performance based treatment systems. If you have any questions or would like to talk about options for **commercial septic system design**, call our experts today. We can work with you to make sure your system accommodates the number of people who will be using the plumbing in the building. We can also design and build systems to accommodate irrigation and other needs. For more information, [contact us](/contact-southern-water-and-soil/ "commercial septic systems experts") today! --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [Dade City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and **[Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/)**, [Florida](/commercial-septic-florida/commercial-septic-system-design/).* ### Similar Services We Offer: --- ### [NSF 245 Septic Systems, Fort Myers, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-fort-myers-fl/nsf-245-septic-systems/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## Our team can help you explore your options regarding an NSF 245 septic system. You might not realize it, but you have many options when it comes to which type of septic system you install. For instance, you can opt for an NSF 245 septic system, also known as an Enhanced Nutrient-Reducing Septic System. Our team at Southern Water and Soil has installed many **NSF 245 septic systems** in the **Fort Myers, Florida** area, and we’d love to talk with you about the many benefits they offer. Continue reading to learn more, and then consider contacting our team for an estimate. ![NSF 245 Septic Systems in Fort Myers, Florida](/wp-content/uploads/2023/08/20230517_120215-cover-res.jpg) NSF 245 septic systems use cutting-edge technologies to make wastewater treatment more effective. These systems go above and beyond the usual ways of treating waste, making the process more thorough and effective. For instance, one of the biggest environmental problems with septic systems is that they release nitrogen into the water, which can cause algae blooms and poor water quality. The goal of NSF 245 devices is to target and lower nitrogen levels, which will reduce any negative effects on local ecosystems. This method is very important for keeping aquatic areas healthy and drinking water sources safe. Since they’re designed to save space, NSF 245 septic systems are perfect for smaller areas. Not only that, but **NSF 245 septic systems** are also more adaptable to different types of soil and site conditions. This flexibility makes them a good choice for many places, even those with high groundwater tables or grounds that don’t allow water through easily. You can also gain peace of mind knowing that the NSF 245 standard has strict certification requirements for septic systems to ensure their safety and efficiency. If you’d like to learn more about NSF 245 septic systems, [contact our team](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we install **NSF 245 septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/nsf-245-septic-systems/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/nsf-245-septic-systems/), [**Fort Myers**](/nitrogen-reducing-septic-system-fort-myers-fl/nsf-245-septic-systems/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/nsf-245-septic-systems/), [Florida](/nitrogen-reducing-septic-system-florida/nsf-245-septic-systems/).* --- ### [NSF 245 Septic Systems, Florida](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-florida/nsf-245-septic-systems/) **Published:** August 21, 2023 **Author:** Southern Water Soil **Content:** ## Let us help you reduce the amount of nitrogen on your property. A nitrogen-reducing septic system is designed to solve the environmental problems of traditional septic systems, specifically the issue of too much nitrogen in the land and nearby water. At Southern Water and Soil, we can install a system that helps reduce this concern. If your **Florida** property has high nitrogen levels, we suggest installing **NSF 245 septic systems**. Continue reading to learn more about nitrogen in your soil, and then give our team a call. ![NSF 245 Septic Systems in Florida](/wp-content/uploads/2023/08/20230517_120215-cover-res.jpg) Nitrogen is a normal part of wastewater, and while septic systems are good at handling many aspects of wastewater, they often fall short regarding nitrogen. This is because traditional septic systems focus primarily on breaking down organic waste and pathogens, leaving nitrogen compounds mostly untouched. When nitrogen-rich treated wastewater is returned to the ground, it can seep into groundwater or nearby surface water, causing environmental and health problems. Installing NSF 245 septic systems is a better way to handle all wastewater components, giving you peace of mind. - **Water Pollution.** Too much nitrogen in water sources causes nutrient pollution, which leads to a process called eutrophication. Eutrophication results when there are too many plants, reducing the amount of oxygen in the water and causing plants and other organisms to die. - **Contamination of Drinking Water.** High amounts of nitrate in drinking water can be dangerous, especially for babies and pregnant women. - **Effects on Aquatic Life.** High amounts of nitrogen upset aquatic ecosystems, making it easier for harmful algal blooms to grow. These blooms can create toxins that hurt fish, shellfish, and other marine animals, causing the food chain to get out of balance. - **Economic Effects.** When too much nitrogen is in the water, leisure activities like fishing, swimming, and boating may no longer be possible, reducing tourism and affecting the economy. As you can see, nitrogen pollution can be a big problem. If you’re concerned about the amount of nitrogen on your property, [call our team](/contact-southern-water-and-soil/) to see if installing **NSF 245 septic systems** is an option. --- *At Southern Water and Soil, we install **NSF 245 septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/nsf-245-septic-systems/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/nsf-245-septic-systems/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/nsf-245-septic-systems/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/nsf-245-septic-systems/), **[Florida](/nitrogen-reducing-septic-system-florida/nsf-245-septic-systems/)**.* --- ### [NSF 245 Septic Systems, Brooksville, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-brooksville-fl/nsf-245-septic-systems/) **Published:** November 2, 2023 **Author:** Southern Water Soil **Content:** ## Property owners can count on us to expertly install NSF 245 septic systems. The National Sanitation Foundation (NSF) has a range of standards for various systems and components used to process and store water. One of the categories it ranks is septic systems, which are commonly used on properties located throughout the United States. The **Brooksville, Florida** area has many properties in rural areas that often rely on septic systems to process and store liquid and solid waste. ![NSF 245 Septic Systems in Brooksville, Florida](/wp-content/uploads/2023/08/20230517_120215-cover-res.jpg) However, as treated water moves through the drain field and back into the soil, it doesn’t undergo any treatment to remove nitrogen. Since this odorless and colorless gas is a common byproduct of human waste, it is typically present in wastewater. But if too much nitrogen enters the groundwater and other sources of water, it can result in devastating effects. **NSF 245 septic systems** are commonly used to combat this problem, and our team at Southern Water and Soil can design and construct them for local clients. This type of system is also referred to as an Enhanced Nutrient-Reducing System, an ENR system, or an Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal System (ENR-OSTDS). Over the years, we have installed NSF 245 septic systems for many property owners located throughout the region. If you’re concerned about high levels of nitrogen causing issues in the water on or around your property, don’t hesitate to contact us to learn more about **NSF 245 septic systems**. We can usually incorporate new components in an existing system to reduce nitrogen, as well as construct complete systems that offer this functionality. To learn more, simply [reach out to our team](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we install **NSF 245 septic systems** in [**Brooksville**](/nitrogen-reducing-septic-system-brooksville-fl/nsf-245-septic-systems/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/nsf-245-septic-systems/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/nsf-245-septic-systems/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/nitrogen-reducing-septic-system-tampa-fl/nsf-245-septic-systems/), [Florida](/nitrogen-reducing-septic-system-florida/nsf-245-septic-systems/).* --- ### [NSF 245 Septic Systems, Tampa, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-tampa-fl/nsf-245-septic-systems/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## Our NSF 245 septic systems help keep Florida’s aquatic environments healthy. Septic and wastewater management systems are essential for maintaining public health, as they remove harmful bacteria and other contaminants from our drinking water. While these systems solve a critical problem, they can create problems in other areas—for example, many of the most popular septic systems in use today release excess nitrogen into the water, which causes algae blooms, among other issues. Our team at Southern Water and Soil offers a way to mitigate this problem with our **NSF 245 septic systems**. ![NSF 245 Septic Systems in Tampa, Florida](/wp-content/uploads/2023/08/20230517_120215-cover-res.jpg) NSF 245 septic systems are a type of Enhanced Nutrient-Reducing Septic Systems, which can also be called Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal Systems (ENR-OSTDS) or ENR septic systems. They are designed to provide the same level of wastewater treatment while also targeting and reducing the amount of nitrogen released into the water. Managing the nitrogen levels is essential for keeping Florida’s lakes, rivers, wetlands, and other aquatic environments healthy. If you are looking for ways to reduce your, your community’s, or your business’ environmental impact, we encourage you to contact our team to learn more about our **NSF 245 septic systems**. Our team will be happy to answer all your questions about these systems, and we can discuss next steps to replace your existing system with one of our nutrient-reducing models. Our team is proud to serve the **Tampa, Florida** area, and we want to help you take care of all your septic needs. If you are interested in learning more about our NSF 245 septic systems, we encourage you to [give us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we install **NSF 245 septic systems** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/nsf-245-septic-systems/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/nsf-245-septic-systems/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/nsf-245-septic-systems/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and **[Tampa](/nitrogen-reducing-septic-system-tampa-fl/nsf-245-septic-systems/)**, [Florida](/nitrogen-reducing-septic-system-florida/nsf-245-septic-systems/).* --- ### [Package Plant Installations, Brooksville, FL](https://southernsepticanddesign.com/package-plant-installations-brooksville-fl/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## You can turn to us to get the expert package plant installations you need for your project. ![Package Plant Installations in Brooksville, Florida](/wp-content/uploads/2024/10/51-resized-300x180-2.jpg)We at Southern Water and Soil have over 30 years of experience in the septic and wastewater management industry. In that time, we have worked extensively on both residential and commercial projects, including **package plant installations**. If you are planning to build a new commercial or industrial facility, you can turn to our team to have us handle the design and installation of the septic system for that building or campus. The first stage in our package plant installations is always planning. Our team will discuss your facility’s needs with you and assess your property to determine the best placement for the various parts of the system. Once we have identified your needs, we will design your system to meet all your requirements, and once you are satisfied with the design, we’ll get to work on the installation process. We’ll take care of all the necessary excavation, pipe and tank installation, and the final cleanup so you don’t have to. Our team is confident you will be more than satisfied with our results. In addition, after the package plant installation is complete, we can provide maintenance and repair services when necessary to keep your system in good working order. Our team is proud to serve the **Brooksville, Florida** area, and we want to help you deal with all your septic needs. If you are looking for a company you can trust to manage your **package plant installations**, we encourage you to [give us a call](/contact-southern-water-and-soil/) to find out more about what we can do for you. --- *At Southern Water and Soil, we offer **package plant installations** in **[Brooksville](/package-plant-installations-brooksville-fl/)**, [Dade City](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Cluster Wastewater Treatment, Brooksville, FL](https://southernsepticanddesign.com/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## You can count on our team to provide the reliable cluster wastewater treatment systems you need. ![Cluster Wastewater Treatment in Brooksville, Florida](/wp-content/uploads/2016/10/CommunityWasteWaterSystem-resized1-300x225.jpg)We at Southern Water and Soil have proudly served communities across the state of Florida for many years, and we understand how important wastewater and septic management are for these areas. In many parts of Florida, home- and business owners use private septic systems to manage their wastewater, but an increasing number of communities and complexes are choosing **cluster wastewater treatment** options, which allow multiple properties to share the same centralized infrastructure for septic and wastewater management. If you are interested in adopting a cluster wastewater treatment system for your development, community, or other property, then we encourage you to turn to our team. One of the main advantages of cluster wastewater treatment is its increased cost effectiveness—using a centralized system to treat and manage waste is cheaper than using dozens (or hundreds) of individual septic tanks. A **cluster wastewater treatment** system has lower installation and long-term costs than the alternative, which is a key factor in why so many developers are choosing this option. In addition, because our team has over 30 years of experience in this industry, you can count on us to provide the effective, reliable solutions you are looking for. Our team is proud to serve the community here in **Brooksville, Florida**, and we want to help you find the septic solutions that work best for you. If you want to learn more about our cluster wastewater treatment options, simply [give us a call](/contact-southern-water-and-soil/). We will gladly provide the answers to any questions you may have on the subject. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in **[Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/)**, [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Tampa, FL](https://southernsepticanddesign.com/package-plant-installations-tampa-fl/cluster-wastewater-treatment/) **Published:** February 17, 2016 **Author:** Southern Water Soil **Content:** ## We often recommend the use of a cluster wastewater treatment system for Tampa, FL communities that want to share the responsibility of maintenance and water quality testing. ![Cluster Wastewater Treatment](/wp-content/uploads/2016/02/CommunityWasteWaterSystem1-300x225.jpg)Today, many communities are using **cluster wastewater treatment** systems to collect and treat wastewater on their properties because of their numerous advantages. For example, with a cluster wastewater treatment system, communities can preserve open areas for farming, soccer fields, parks, and other recreational activities, and storm water production can be significantly reduced. At Southern Water and Soil, we often recommend the use of a cluster wastewater treatment system for communities in Tampa, Florida that want to share the responsibility of maintenance, water quality testing, and other related tasks. We realize that having an aeration module to maintain at every home or business can become a daunting endeavor and believe that spreading treatment modules throughout the community in clusters is often an advantageous solution for certain locations. When our team designs and installs **cluster wastewater treatment** systems, we use textile-based systems since they allow for the treatment of wastewater in relatively compact areas. In addition to the standard benefits that come from using a cluster system, textile-based systems offer a number of other advantages. For instance, these systems: - Do not produce foul odors - Do not require extended aeration or noisy blowers - Use up to 95 percent less energy to operate - Decrease the production of bio-solids by up to 90 percent - Feature a compact and modular design, which allows for expansion over time - Can significantly reduce operation and maintenance costs for communities - Feature media that does not have to be replaced as time passes These systems also continue to perform during power outages and storms and promote a sustainable overall environment. If you are interested in having a cluster system installed for community use, we would be more than happy to provide you with further information. Please [contact us](/contact-southern-water-and-soil/) today at Southern Water and Soil to speak with one of our friendly representatives. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and **[Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/)**, [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Spring Hill, FL](https://southernsepticanddesign.com/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/) **Published:** May 5, 2024 **Author:** Southern Water Soil **Content:** ## You can count on our team to design and build the perfect cluster wastewater treatment solutions for your needs. ![Cluster Wastewater Treatment in Spring Hill, Florida](/wp-content/uploads/2016/02/CommunityWasteWaterSystem1-300x225.jpg)Our team at Southern Water and Soil has extensive experience in the septic and wastewater management industries. Both are important concerns here in **Spring Hill, Florida**, and we can help you get the reliable solutions you need for your property and community. In many areas, every home or business has its own private septic system, but many developers today are instead using **cluster wastewater treatment** systems, which allow multiple properties to share centralized infrastructure for wastewater collection, treatment, and dispersal. If you are interested in learning more about cluster wastewater treatment, we encourage you to reach out to our team. We can provide information about how these systems work and the benefits they have to offer. As we alluded to above, one of their key advantages is their increased cost-effectiveness compared to individual private septic systems—instead of having to install a septic tank on each property in your development, you can instead tie all the properties into a single shared system, which keeps the installation and operating costs down. We have over 30 years of experience in septic engineering and wastewater treatment, so you can count on us to deliver the reliable solutions you need. Our team has provided solutions for homeowners, business owners, land developers, and many more. If you want to learn more about **cluster wastewater treatment** systems, we encourage you to [reach out to our team](/contact-southern-water-and-soil/) at your earliest convenience. We will be more than happy to provide answers to any questions you may have. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [**Spring Hill**](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Orlando, FL](https://southernsepticanddesign.com/package-plant-installations-orlando-fl/cluster-wastewater-treatment/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## Cluster wastewater treatment helps to reduce storm water production, as well as preserve open areas in your community in Orlando. ![Cluster Wastewater Treatment, Orlando in Florida](/wp-content/uploads/2016/10/CommunityWasteWaterSystem-resized.jpg)If your community is looking for an alternative to its current septic system due to zoning and other ordinances, you may be looking at a variety of solutions. Whether you have open space you would like to maintain or you would like to decentralize your wastewater treatment system, at Southern Water and Soil, we believe **cluster wastewater treatment** can be a good option for your community in Orlando, Florida. Cluster wastewater treatment helps to reduce storm water production, as well as preserve open areas where traditional systems would not work. At Southern Water and Soil, we can assist your community by designing and implementing a cluster wastewater treatment system that allows you to achieve your goals. Using a textile-based system, modules are installed throughout your community, which are then maintained by residents. This approach allows your community to test for water quality and maintain its wastewater system while preserving open areas used for farming, parks, and recreational activities. Advantages of a cluster wastewater treatment system include: - A compact design that allows for expansion over time - Decrease in production of bio-solids - No foul odors or extended aeration required - Performance during power outages and storms - Promotes sustainability - Reduced operation and maintenance costs - Uses 95% less energy during operation At Southern Water and Soil, we have more than 30 years of experience assisting communities and commercial businesses with the design, installation and maintenance of their wastewater systems. [Contact us](/contact-southern-water-and-soil/) today for more information about **cluster wastewater treatment** for your community in Orlando. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), **[Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/)**, Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Odessa, FL](https://southernsepticanddesign.com/package-plant-installations-odessa-fl/cluster-wastewater-treatment/) **Published:** March 29, 2016 **Author:** Southern Water Soil **Content:** ## If you are interested in pursuing the idea of your community in Odessa, FL using a cluster wastewater treatment system, we are here to help. **![Cluster Wastewater Treatment](/wp-content/uploads/2016/02/CommunityWasteWaterSystem1-300x225.jpg)Cluster wastewater treatment** systems are becoming more and more popular today for their numerous advantages. For example, when a community uses a cluster wastewater treatment system, the production of storm water can be greatly reduced and communities can keep open areas available for parks, soccer fields, and other purposes. If you are interested in pursuing the idea of your community using a cluster wastewater treatment system, our team at Southern Water and Soil is here to help. We often recommend the use of these systems to communities throughout the Odessa, Florida area that want to share the management and responsibility of water quality testing, maintenance, and other tasks. We also often suggest the use of these systems because they are energy efficient, they do not product foul odors, and their compact, modular design allows for expansion over time. Our team can precisely design and install cluster wastewater treatment systems for communities of all sizes, especially those that exist in compact locations. Not only will we ensure that cluster wastewater treatment is the right solution for your community, but we will also carefully put together a system that maximizes the efficiency and sustainability of the wastewater treatment system at your location. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today to find out more about **cluster wastewater treatment** systems and how they work. We value being your source of information and look forward to hearing from you. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), **[Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/)**, [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Miami, FL](https://southernsepticanddesign.com/package-plant-installations-miami-fl/cluster-wastewater-treatment/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## We can assist your community by designing and implementing a cluster wastewater treatment system in Miami. ![Cluster Wastewater Treatment in Miami, Florida](/wp-content/uploads/2016/10/CommunityWasteWaterSystem-resized1-300x225.jpg)Is your community working to achieve a more sustainable approach to wastewater treatment? Are you looking for cost-effective septic solutions? At Southern Water and Soil, we have more than 30 years of experience assisting communities and commercial businesses with the design, installation and maintenance of their wastewater systems. So, when your community is looking for an alternative to traditional gravity waste management systems, we are prepared to discuss your options. One solution many communities find effective when they are seeking wastewater treatment solutions due to zoning and other ordinances is **cluster wastewater treatment**. These systems allow you to preserve open spaces you would like to maintain and decentralize your wastewater treatment system. Cluster wastewater treatment works to reduce storm water production and preserve open areas, such as farms, parks and recreational areas, where traditional septic systems would not work. Additional advantages of cluster wastewater treatment include a decreased production in bio-solids, reduced operation and maintenance costs, and promotion of sustainability with the option to expand the system over time. Using a textile-based system, we will install modules throughout your community that can be easily maintained by community members. Your community may see a 95% reduction in energy expenditures, won’t have to worry about foul odors or extended aeration requirements, and can expand the system as needed over time. At Southern Water and Soil, we can assist your community by designing and implementing a **cluster wastewater treatment** system in Miami, FL. [Contact us](/contact-southern-water-and-soil/) today for more information about cluster wastewater treatment for your community. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), **[Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/)**, [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Lutz, FL](https://southernsepticanddesign.com/package-plant-installations-lutz-fl/cluster-wastewater-treatment/) **Published:** February 22, 2016 **Author:** Southern Water Soil **Content:** ## Communities in Lutz, FL that want to cumulatively manage maintenance, water quality testing, and other related tasks may benefit from using a cluster wastewater treatment system. **![Cluster Wastewater Treatment](/wp-content/uploads/2016/02/CommunityWasteWaterSystem1-300x225.jpg)Cluster wastewater treatment** systems are becoming more and more popular in communities throughout the Lutz, Florida area today due to their many benefits. For example, communities can preserve areas for parks, soccer fields, farming, and other recreational activities when they use cluster wastewater treatment to collect and treat wastewater. Additionally, with the use of one of these systems, storm water production can be significantly minimized. If your community wants to share the responsibility of water quality testing, maintenance, and other related tasks, at Southern Water and Soil, we might recommend the use of a cluster wastewater treatment system. Having an aeration module to maintain at every individual business or home can be an overwhelming endeavor, and we realize that placing treatment modules in clusters throughout a community is often an advantageous alternative. We use textile-based systems when we install cluster wastewater systems because they can treat wastewater in smaller, more compact places. These systems are also beneficial because they do not give off foul odors, use 95 percent less energy than traditional systems, and feature a modular design, which allows communities to expand the system over time. These systems also do not use noisy blowers, promote a sustainable overall environment, and reduce maintenance and operation costs. We would be more than happy to provide you with further information about **cluster wastewater treatment** systems and how these systems work. Please [reach out to us](/contact-southern-water-and-soil/) at Southern Water and Soil today to speak with one of our friendly, knowledgeable representatives. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [**Dade City**](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), **[Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/)**, [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Land O’ Lakes, FL](https://southernsepticanddesign.com/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/) **Published:** June 7, 2016 **Author:** Southern Water Soil **Content:** ## Cluster wastewater treatment has become an increasingly popular option for communities in Land O’ Lakes that would like to preserve open areas and reduce storm water production in their area. ![Cluster Wastewater Treatment in Land O’ Lakes, Florida](/wp-content/uploads/2016/02/CommunityWasteWaterSystem1-300x225.jpg)Is your community looking for a way to decentralize its wastewater treatment system due to zoning or other ordinances? Would you like to find an alternative solution to your community’s septic system, so you can maintain your open space? **Cluster wastewater treatment** has become an increasingly popular option for communities that would like to preserve open areas and reduce storm water production in their area. At Southern Water and Soil, we can assist your community in the design and implementation of a cluster wastewater treatment system that allows you to achieve your goals and maintain your space. Using a textile-based system, we design and install cluster wastewater treatment systems in modules through your community. This allows your community members to assist in the maintenance, water quality testing, and other tasks related to wastewater treatment without becoming overwhelmed. By taking this approach, your community can maintain its open areas used for farming, parks, recreational activities, and other important uses. There are several advantages to using cluster wastewater treatment systems, including: - Performance during power outages and storms, promoting sustainability - Using 95% less energy during operation - A compact and modular design that allows for expansion over time - Does not produce foul odors or require extended aeration - Decrease in production of bio-solids - Reduced operation and maintenance costs for your community If you are interested in learning more about how **cluster wastewater treatment** would be beneficial for your community in Land O’ Lakes, Florida, please [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil for more information. With more than 30 years of combined experience providing our customers with the wastewater treatment solutions they need, we are happy to assist you in maintaining and preserving your community. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), **[Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/)**, [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Fort Myers, FL](https://southernsepticanddesign.com/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/) **Published:** July 11, 2016 **Author:** Southern Water Soil **Content:** ## Depending on your Fort Myers community’s circumstances, a cluster wastewater treatment system may be the right fit. **![Cluster Wastewater Treatment in Fort Myers, Florida](/wp-content/uploads/2016/07/CommunityWasteWaterSystem-300x225.jpg)Cluster wastewater treatment** is associated with many different advantages. For instance, many communities in Fort Myers, Florida use these wastewater treatment systems because open areas can be preserved for soccer fields, parks, farming, and other recreational uses. Additionally, when one of these systems is in use, the production of storm water can be minimized. If your community wants to share the responsibility of water quality testing, maintenance, and other tasks, at Southern Water and Soil, we recommend using a cluster wastewater treatment system. Maintaining an Advantex unit at each individual business or home can be daunting, but spreading out these modules throughout the community can lessen the burden. Our team installs and designs textile-based cluster wastewater treatment systems because, on top of the standard benefits that come from using a cluster system, they are advantageous for many other reasons. For example, these systems do not use noisy blowers or produce foul odors. They also can be expanded over time, thanks to their compact, modular design, and they can decrease bio-solid production by up to 90 percent. Plus, when the power goes out, they continue to perform. Depending on your community’s circumstances, a **cluster wastewater treatment** system may be the right fit. If you would like to know more about these systems and whether your community could benefit, [get in touch with us](/contact-southern-water-and-soil/) at Southern Water and Soil today. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), **[Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/)**, [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Cluster Wastewater Treatment, Florida](https://southernsepticanddesign.com/package-plant-installations-florida/cluster-wastewater-treatment/) **Published:** March 20, 2024 **Author:** Southern Water Soil **Content:** ## We give you affordable, simplified, and sustainable wastewater infrastructure. ![Cluster Wastewater Treatment in Florida](/wp-content/uploads/2016/10/CommunityWasteWaterSystem-resized1-300x225.jpg)For private communities, multi-resident developments, or commercial facilities seeking advanced, large-scale wastewater solutions in **Florida**, cluster treatment systems provide sustainable and efficient processing powered by group participation. **Cluster wastewater treatment** allows multiple properties near one another to share centralized infrastructure for onsite collection, treatment, and water recycling and dispersal post-processing. It is especially helpful for remote or rural areas, and this setup is ideal for HOAs, condo complexes, apartment buildings, malls, office parks, and other concentrated establishments with high combined wastewater output. Rather than cost-prohibitive individual private treatment for each unit, cluster systems gather effluent streams to treat collectively. Advanced recycling technology captures treated effluent for sustainable non-potable uses like landscape irrigation, reducing municipal water demands. When you share expenses for permitting, construction, operation, maintenance, and repairs across stakeholders, the system is more affordable than a one-off plant. We offer clear pricing on all our services, and we have a customer-first mentality, so you get continued transparency throughout the process. With over 30 years of experience as a specialized wastewater engineering firm serving developers, builders, community associations, and businesses, our team at Southern Water and Soil has the knowledge to design **cluster wastewater treatment** solutions. We plan and coordinate permits from the Florida Department of Health and other regulatory agencies, and we have strong relationships with approving agencies and have plenty of experience securing permits for cluster wastewater treatment projects. To learn more about innovative and cost-effective cluster wastewater treatment systems for your property, [contact us today](/contact-southern-water-and-soil/) to speak with our team. Discover how cluster wastewater treatment provides affordable, simplified, and sustainable wastewater infrastructure. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [Dade City](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), **[Florida](/package-plant-installations-florida/cluster-wastewater-treatment/)**.* --- ### [Cluster Wastewater Treatment, Dade City, FL](https://southernsepticanddesign.com/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## We often recommend the use of a cluster wastewater treatment system for Dade City, FL communities that want to share the responsibility of maintenance and water quality testing. ![Cluster Wastewater Treatment in Dade City, Florida](/wp-content/uploads/2016/02/CommunityWasteWaterSystem1-300x225.jpg)Today, many communities are using **cluster wastewater treatment** systems to collect and treat wastewater on their properties because of their numerous advantages. For example, with a cluster wastewater treatment system, communities can preserve open areas for farming, soccer fields, parks, and other recreational activities, and storm water production can be significantly reduced. At Southern Water and Soil, we often recommend the use of a cluster wastewater treatment system for communities in **Dade City, Florida** that want to share the responsibility of maintenance, water quality testing, and other related tasks. We realize that having an aeration module to maintain at every home or business can become a daunting endeavor and believe that spreading treatment modules throughout the community in clusters is often an advantageous solution for certain locations. When our team designs and installs **cluster wastewater treatment** systems, we use textile-based systems since they allow for the treatment of wastewater in relatively compact areas. In addition to the standard benefits that come from using a cluster system, textile-based systems offer a number of other advantages. For instance, these systems: - Do not produce foul odors - Do not require extended aeration or noisy blowers - Use up to 95 percent less energy to operate - Decrease the production of bio-solids by up to 90 percent - Feature a compact and modular design, which allows for expansion over time - Can significantly reduce operation and maintenance costs for communities - Feature media that does not have to be replaced as time passes These systems also continue to perform during power outages and storms and promote a sustainable overall environment. If you are interested in having a cluster system installed for community use, we would be more than happy to provide you with further information. Please [contact us](/contact-southern-water-and-soil/) today at Southern Water and Soil to speak with one of our friendly representatives. --- *At Southern Water and Soil, we install **cluster wastewater treatment** systems in [Brooksville](/package-plant-installations-brooksville-fl/cluster-wastewater-treatment/), [**Dade City**](/package-plant-installations-dade-city-fl/cluster-wastewater-treatment/), [Fort Myers](/package-plant-installations-fort-myers-fl/cluster-wastewater-treatment/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/cluster-wastewater-treatment/), [Lutz](/package-plant-installations-lutz-fl/cluster-wastewater-treatment/), [Miami](/package-plant-installations-miami-fl/cluster-wastewater-treatment/), [Odessa](/package-plant-installations-odessa-fl/cluster-wastewater-treatment/), [Orlando](/package-plant-installations-orlando-fl/cluster-wastewater-treatment/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/cluster-wastewater-treatment/), and [Tampa](/package-plant-installations-tampa-fl/cluster-wastewater-treatment/), [Florida](/package-plant-installations-florida/cluster-wastewater-treatment/).* --- ### [Commercial Septic System Design, Brooksville, FL](https://southernsepticanddesign.com/commercial-septic-brooksville-fl/commercial-septic-system-design/) **Published:** October 11, 2024 **Author:** Southern Water Soil **Content:** ## Our team has the right experience to create the ideal commercial septic system design for you property. ![Commercial Septic System Design in Brooksville, Florida](/wp-content/uploads/2016/10/Please-make-sure-to-include-this-one-2012-01-18-13.38.23-resized1-300x179.jpg)In the state of Florida, it is very common for homes and businesses to use private septic systems to manage their waste rather than a municipal sewer system. If you need a septic system for your property, you can turn to our team at Southern Water and Soil. Our experts have over 30 years of experience in this field, and you can count on us to provide the reliable solutions you are looking for. For instance, we offer **commercial septic system design** services to help business owners ensure their offices, storefronts, or other facilities have a reliable way to manage waste. Our team has the right experience to deal with any difficulty in septic and wastewater management. When you come to us for commercial septic system design services, we will assess your property and create the ideal design to ensure all waste gets where it needs to go and is treated effectively. For example, if we need to place the septic tank uphill of your building, we will include a sump pump to ensure the effluent can flow into the tank, even with gravity pulling it downhill. We also offer a variety of options for secondary and advanced treatment systems. We are proud to serve the community here in **Brooksville, Florida**, and we want to help you find solutions for all your septic needs. If you are looking for experts you can trust to take care of your **commercial septic system design** requirements, just [give our team a call](/contact-southern-water-and-soil/) to find out more about what we can do for you. --- *At Southern Water and Soil, we offer **commercial septic system design** services in **[Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/)**, [Dade City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Commercial Septic System Design, Plant City, FL](https://southernsepticanddesign.com/commercial-septic-plant-city-fl/commercial-septic-system-design/) **Published:** October 3, 2021 **Author:** Southern Water Soil **Content:** ## We take all aspects into account when coming up with your property’s commercial septic system design. ![Commercial Septic System Design in Plant City, Florida](/wp-content/uploads/2014/07/2012-01-18-13.38.23-300x179.jpg)While there are certain complexities involved with designing a residential septic system, it is important to know that the nature of **commercial septic system design** is such that you should only trust an experienced professional when you need a system for your **Plant City, Florida** commercial project. At Southern Water and Soil, we understand that a cookie-cutter solution is the worst possible way to go. We’ll take the time to fully understand your objectives and assess the property to come up with the best possible commercial septic system design. We have 30 years of combined experience, so we know our way around designing the right system, handling the permit application process, and installing all types of systems, including aerobic septic systems and other performance-based treatment systems. We have the expertise to know when a lift station pump is needed or any other advanced treatment system to give you a reliable commercial septic system design. You can count on us to take the time to learn about your property’s intended use and any future plans you might have that should also be accommodated with your commercial septic system design. We’ll make certain that all your questions and concerns are addressed so you are confident with moving forward with your project. We will be here for you in the years ahead, as well, so when you need commercial septic system maintenance or repairs, don’t hesitate to reach out to us. [Contact us today](/contact-southern-water-and-soil/) to learn more about our commercial septic services or get started with the development of a **commercial septic system design** for your property. --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [Dade City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), **[Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/)**, Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Commercial Septic System Design, Orlando, FL](https://southernsepticanddesign.com/commercial-septic-orlando-fl/commercial-septic-system-design/) **Published:** October 18, 2017 **Author:** Southern Water Soil **Content:** ## Our experience in commercial septic system design ranges from effluent sewers to cluster wastewater treatment and package plant installations in Orlando. ![Commercial Septic System Design in Orlando, Florida](/wp-content/uploads/2017/10/Commercial-Septic-System-Design.jpg) As you consider every aspect of the way your business operates, your commercial septic system may come into question. Does it have the proper design? Will it last you for many years? What kind of maintenance will it need? At Southern Water and Soil, we can answer these questions and provide you with the expert services required to achieve your most functional commercial wastewater system in **Orlando, Florida**. As your commercial septic company of choice, we can ensure that your wastewater system is set up for success, including in the initial stages of your commercial septic system design. We can troubleshoot landscaping challenges, make recommendations for the appropriate system type, and provide a complete installation. Our experience in **commercial septic system design** ranges from effluent sewers to cluster wastewater treatment and package plant installations. We also offer real estate sale septic inspections and can determine the best maintenance plan for your property in Orlando. Whether you call on us for commercial septic system design for a single property or you would like to make sure your entire community has a functioning wastewater management solution, you’ll find that we go above and beyond to provide the services you need. Your satisfaction is important to us. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today for more information about **commercial septic system design** and how we can provide the commercial septic services you need for any system type. We will be happy to answer your questions and provide full-scale solutions. We look forward to working with you. --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [Dade City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [**Orlando**](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Commercial Septic System Design, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-system-design/) **Published:** September 29, 2015 **Author:** Southern Water Soil **Content:** ## Proper commercial septic system design on your Odessa, FL property will pay back dividends for many years in both cost savings and peace of mind. **![Commercial Septic System Design](/wp-content/uploads/2015/09/2012-11-20-12.45-resize-300x169.jpg)Commercial septic system design** is a simple and effective way to ensure that your business or commercial property has effective septic services that are properly designed, correctly installed with minimal headache, and maintained properly. Like any other aspect of your business, the time spent ensuring a properly designed and executed septic system will pay back dividends for many years in both cost savings and peace of mind. The first step in **commercial septic system design** is to determine the waste water treatment needs of the property. Consider the business or businesses that are on the property and their needs for waste water treatment and septic systems. By having an idea of the requirements and potential stresses on the system, safeties and redundancies can be tailored to the business or businesses in question. The second step of commercial septic system design is the placement of the system. Because of the potentially large demand on the system, it’s important to identify where the system can be placed in relationship to the building. Take into account how the business or businesses will use any area in which the septic system could be placed, especially as vehicles driving over top of a septic system can compromise the entire system in an instant. At Southern Water and Soil, we have years of experience in both residential and commercial septic system design. We help our clients in **Odessa, Florida** in every step of the process, from design to permitting to installation and maintenance. Let our expert team help you today! --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [Dade City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), **[Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/)**, [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Commercial Septic System Design, Miami, FL](https://southernsepticanddesign.com/commercial-septic-miami-fl/commercial-septic-system-design/) **Published:** October 25, 2016 **Author:** Southern Water Soil **Content:** ## We are available to answer any questions you might have about commercial septic system design and discuss the wastewater systems that may work best for your community in Miami. ![Commercial Septic System Design in Miami, North Carolina](/wp-content/uploads/2016/10/Please-make-sure-to-include-this-one-2012-01-18-13.38.23-resized1-300x179.jpg)At Southern Water and Soil, our goal is always to provide you with **commercial septic system design** services that exceed your expectations in Miami, FL. We realize that you need an exceptional team who can provide informative and reliable services when you need commercial septic solutions. Our team has been providing high-quality wastewater solutions for over three decades that have helped a number of small or mid-sized communities get the best results. When it comes to commercial septic system design, our knowledgeable, reliable and professional team is prepared to handle the job. At Southern Water and Soil, we offer a number of different services as a part of commercial septic system design, so your community has alternatives to traditional wastewater management if needed. Not only can we assist with the process of designing your commercial septic system, but we are knowledgeable about a variety of different wastewater treatment systems that truly allow you to choose the system that will best meet your needs. Once you have determined the best route, we’ll work with you from design to completion. Whether you are interested in effluent sewers, cluster wastewater treatment systems, package plant installations or another wastewater system, our team is equipped to handle your **commercial septic system design** and installation. We partner with Orenco to provide high-quality wastewater systems for communities, so they have long-term, sustainable wastewater solutions. When you work with us at Southern Water and Soil, you can expect full-service septic solutions. We are available to answer any questions you might have about commercial septic system design and discuss the wastewater systems that may work best for your community. [Contact us today](/contact-southern-water-and-soil/) to get started. --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [Dade City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), **[Miami](/commercial-septic-miami-fl/commercial-septic-system-design/)**, [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Commercial Septic System Design, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-system-design/) **Published:** January 20, 2016 **Author:** Southern Water Soil **Content:** ## Make sure your septic system provides for the needs of your Lutz, FL home or business with custom commercial septic system design. ![Commercial Septic System Design, Lutz, FL](/wp-content/uploads/2016/01/2012-01-26-13.06.02-300x179.jpg)Commercial septic system design may seem like a simple task at first, but a lot of thought and planning go into the process. For one thing, the size of your septic tank will be determined by the size of your business. The location for installation is another important factor to consider—it will be determined by the layout of the land on your property. There are also a number of drain field options to think about. These factors are just a few of the considerations that go into a **commercial septic system design**. A quality design will be custom-made for both the septic tank and the drain field to ensure that wastewater flows properly from your property into the system, and then back into the environment. Having a septic system custom-designed is essential for businesses both large and small in **Lutz, Florida**. If you want to make sure your septic system is designed to suit the needs of your business, make Southern Water and Soil your first call. We have more than 30 years of experience in the industry, so we are experts in **commercial septic system design**. As Southern Water and Soil, we are highly experienced in the field of commercial septic system design, so you can count on us to get the job done right. Just [give us a call today](/contact-southern-water-and-soil/) for a free consultation or to schedule an appointment with one of our engineers. If you choose to hire us, you can rest assured that we will keep you informed every step of the way, so you have peace of mind knowing that the job is being done correctly. --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [Dade City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), **[Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/)**, [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Commercial Septic System Design, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/) **Published:** June 7, 2016 **Author:** Southern Water Soil **Content:** ## To find out more about commercial septic system design in Land O’ Lakes, reach out to us today. ![Septic Tank and Drainfield Installation](/wp-content/uploads/2015/06/Septic-Tank-and-Drainfield-Installation-300x179.jpg)You want your commercial septic company to be knowledgeable, reliable and professional. At Southern Water and Soil, we think you should turn all of your septic needs over to us because we are all of these things and more. We offer a number of different services, including commercial septic system design, so your community has alternatives to traditional wastewater management. As a septic company with three decades of combined experience, we realize how important customer satisfaction is. Due to this, we can provide you with **commercial septic system design** services to exceed your expectations, provide wastewater solutions, and help your small or mid-sized community achieve its goals. Our expertise is invaluable when it comes to effluent sewers, cluster wastewater treatment systems, package plant installations and much more. We can also assist customers with real estate sale septic inspections and maintenance plans that keep your septic system working properly. Additionally, we partner with Orenco to provide high-quality wastewater systems for any community. At Southern Water and Soil, we will not just simply provide you with needed services and then call it a day. We also take the time to provide full septic services, so your system continues to run efficiently from year to year. We are available to answer any questions you might have and give you advice about **commercial septic system design**. To find out more about commercial septic system design in **Land O’ Lakes, Florida**, [reach out](/contact-southern-water-and-soil/) to us today. We look forward to hearing from you. --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [Dade City](/commercial-septic-brandon/commercial-septic-design/), [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), **[Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/)**, [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Commercial Septic System Design, Fort Myers, FL](https://southernsepticanddesign.com/commercial-septic-fort-myers-fl/commercial-septic-system-design/) **Published:** February 19, 2024 **Author:** Southern Water Soil **Content:** ## A detailed septic system design will ensure a long-lasting and effective solution. ![Commercial Septic System Design in Fort Myers, Florida](/wp-content/uploads/2016/10/Please-make-sure-to-include-this-one-2012-01-18-13.38.23-resized1.jpg)When it comes to the infrastructure of a commercial property, there’s an unsung hero that often goes unnoticed, and that’s the septic system. However, no septic system can work properly without a thorough **commercial septic system design** that takes multiple factors into consideration. At Southern Water and Soil, we not only understand the importance of a good septic system design, but we also work hard to ensure that no detail goes unnoticed as we plan your new system. A commercial septic system design needs to be highly detailed to ensure that the finished system will work reliably and efficiently while meeting all local and national regulations. Commercial septic systems are responsible for treating wastewater without harming the nearby environment, and a well-designed septic system will prevent soil and water sources from becoming polluted with untreated wastewater. If you need a new septic system for your **Fort Myers, Florida** commercial property, you can rest easy knowing that our experienced and knowledgeable team is on your side. We have decades of experience in this region, so our commercial septic system design will be compliant with every rule and regulation. Finally, the wastewater that businesses produce varies. By understanding your needs as well as other factors, we can provide you with a commercial septic system design that meets those needs and helps your system effectively handle the amount and type of wastewater created. This capability will ensure that your septic system will work well and last for many years to come. A thoughtful **commercial septic system design** is an investment in the longevity and dependability of your business, as well as the health of the community. [Contact our team](/contact-southern-water-and-soil/) today to learn more. --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), [Dade City](/commercial-septic-brandon/commercial-septic-design/), [**Fort Myers**](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Commercial Septic Design, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-design/) **Published:** March 29, 2021 **Author:** Southern Water Soil **Content:** ## Let our experts get you the right commercial septic system design for your property. ![Commercial Septic Design in Dade City, Florida](/wp-content/uploads/2016/10/Please-make-sure-to-include-this-one-2012-01-18-13.38.23-resized1.jpg) When you need a septic system for your property, you have a plethora of companies to choose from and other choices to make. Choosing a **commercial septic system design** can be tricky because not every septic company has the skills or capabilities to create septic system that will meet the needs of various commercial properties. Here at Southern Water and Soil, we want to help you with your commercial septic system needs in the **Dade City, Florida** area, starting with finding you the right design. We offer a variety of features to ensure your commercial property can get the best in design for your septic system. We offer everything from lift pumps that can aid in the transportation of materials on sloped properties to options that are performance-based. With additional features that include aerobic treatment units, low-pressure dosing systems, advanced treatment systems, and secondary treatment systems, you will have the right blend of components to create the ideal **commercial septic system design** for your property. When you are looking for the best in commercial septic system design, you need our team of experts working with you. We take care of the permitting, installation, engineering, and design for your commercial property, leaving you to sit back and enjoy the efficient progress we are making on your behalf. We offer a variety of discounts that you might be interested in, including discounts for teachers, military members, and seniors. If you have questions about our commercial septic system design, we are here to help. For more information about the variety of services we offer for commercial properties like yours, please [give us a call today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we offer **commercial septic system design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-system-design/), **[Dade City](/commercial-septic-brandon/commercial-septic-design/)**, [Fort Myers](/commercial-septic-fort-myers-fl/commercial-septic-system-design/), [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-system-design/), [Miami](/commercial-septic-miami-fl/commercial-septic-system-design/), [Odessa](/commercial-septic-odessa-fl/commercial-septic-system-design/), [Orlando](/commercial-septic-orlando-fl/commercial-septic-system-design/), [Plant City](/commercial-septic-plant-city-fl/commercial-septic-system-design/), Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-system-design/), [Florida](/commercial-septic-florida/commercial-septic-system-design/).* --- ### [Package Plant Installations, Tampa, FL](https://southernsepticanddesign.com/package-plant-installations-tampa-fl/) **Published:** February 17, 2016 **Author:** Southern Water Soil **Content:** ## Our team has over three decades of experience performing package plant installations in Tampa, FL and is committed to your complete satisfaction. ![Package Plant Installations](/wp-content/uploads/2016/02/51-resized-300x180.jpg)Businesses or residences that are not connected to the municipal water system generally rely on a septic system for their wastewater treatment needs. However, not every property is a good candidate for a septic system. In cases like these, at Southern Water and Soil, we may recommend a package treatment plant to treat wastewater on your property. Our team has over three decades of experience performing **package plant installations** in Tampa, Florida and is committed to your complete satisfaction. Before we perform package plant installations, we make sure that our client is fully aware of how their new system will function. To give you a better feel for how these systems work, package treatment plants come with a multi-chamber tank. This is different than traditional septic systems because package treatment plants use an aerobic digestive process to treat the raw sewage. Package wastewater treatment systems also treat wastewater in three different stages. During the first stage, the sewage enters a pre-treatment chamber where heavy solids sink to the bottom, and lighter waste, like oils and grease, remain at the top. Second, the liquid mixture and the scum are mixed with oxygen, and aerobic bacteria reduce the sewage into simple compounds. Finally, the heavier solids and the effluent are separated in the clarification chamber and are returned to the aeration chamber for additional processing. The leftover clarified liquid is then transported to the environment for disposal. When our team performs **package plant installations**, we use Orenco and Norweco products. One of the main reasons why we have formed a partnership with this leading manufacturers of wastewater treatment products is because they offer top of the line systems for municipal areas to the single family home. If you would like to find out more about package plant systems, how they work, and why they are a beneficial wastewater treatment option, [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil. We look forward to hearing from you! --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), [Dade City](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and **[Tampa](/package-plant-installations-tampa-fl/)**, [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Package Plant Installations, Spring Hill, FL](https://southernsepticanddesign.com/package-plant-installations-spring-hill-fl/) **Published:** May 5, 2024 **Author:** Southern Water Soil **Content:** ## You can count on us to take care of all your package plant installation needs. ![Package Plant Installations in Spring Hill, Florida](/wp-content/uploads/2016/02/51-resized-300x180.jpg)When building a new commercial property, one thing you will need to figure out is how to deal with sewage and wastewater. Without a good system in place to deal with these matters, you won’t be able to maintain smooth operations, and your facility will not be compliant with local regulations. Fortunately, our team at Southern Water and Soil can help with these matters. We have extensive experience in the septic industry, and we can provide **package plant installations** services—in other words, we will design and install the ideal system to manage your facility’s waste. Our package plant installations always start with careful planning. We will survey your property and assess your facility’s treatment needs, then design a custom system to service them. Once we have finalized the design and double-checked our calculations, we will get to work on the installation process itself, taking care of all the excavation and installing the various pipes, pumps, filters, etc. needed to create your package plant. Then, we’ll move all the soil back into place and handle all necessary cleanup. We are confident that you will be more than satisfied with our results. If you have any questions, don’t hesitate to reach out to us. Our team is proud to serve the **Spring Hill, Florida** area, and we want to help you with all your septic needs. If you are looking for a team you can trust to handle **package plant installations**, simply [give us a call](/contact-southern-water-and-soil/) to learn more about what we can do for you. --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), [Dade City](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [**Spring Hill**](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Package Plant Installations, Orlando, FL](https://southernsepticanddesign.com/package-plant-installations-orlando-fl/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## Your package plant installations in Orlando will go smoothly with our design, installation, and maintenance services. ![Package Plant Installations in Orlando, Florida](/wp-content/uploads/2016/10/2012-10-22-09.56.16-resized.jpg)At Southern Water and Soil, we are your number one resource when you need a team to assist with the wastewater portion of your package plant installation in Orlando, Florida. We have more than three decades of experience in commercial wastewater treatment systems, and if you have a developmenct site for your new package plant installation, we are equipped to handle the design and installation of your wastewater system from start to finish. It’s important to have a team who is knowledgeable about how to achieve the best outcomes, and at Southern Water and Soil, we are committed to high-quality results. When it comes to large-scale wastewater systems, we have extensive knowledge of development site codes and the latest technologies, and we work to ensure your **package plant installations** function exactly as they should. Our team at Southern Water and Soil is fully licensed, bonded and insured, and you can expect us to provide accurate quotes and proposals that take into account all of the factors at your site. We are experts at package plant installations that align with local requirements, and we are dedicated to an informative approach, so you, as our valued customer, can see first-hand the benefits of working with our team. We partner with top manufacturers so you feel confident your system is of the highest quality, and we also take into account material costs, the type of commercial septic system you need, and your total budget. Your package plant installations will go smoothly with our design, installation, and maintenance services. Here at Southern Water and Soil, we are committed to your satisfaction and work to exceed your expectations during **package plant installations** in Orlando. [Contact us](/contact-southern-water-and-soil/) today to learn more about how we can assist you. --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), Dade City, [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), **[Orlando](/package-plant-installations-orlando-fl/)**, Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Package Plant Installations, Odessa, FL](https://southernsepticanddesign.com/package-plant-installations-odessa-fl/) **Published:** March 29, 2016 **Author:** Southern Water Soil **Content:** ## When we work on package plant installations in Odessa, FL, the first thing we always do is make sure our client completely understands the basic functionality of their new system. ![Package Plant Installations](/wp-content/uploads/2016/02/51-resized-300x180.jpg)Septic systems are most often used in cases in which a residence or business cannot be hooked up to the municipal water system. However, this does not mean that every property can benefit from using septic. At Southern Water and Soil, we often recommend package plant treatment systems to treat wastewater on properties in Odessa, Florida if neither septic nor the city water system will beneficially meet the location’s wastewater needs. When we work on **package plant installations**, the first thing we always do is make sure our client completely understands the basic functionality of their new system. If you are unfamiliar with package plants, these systems generally come with a multi-chamber tank. This varies from a traditional septic system because an aerobic digestive process is employed to naturally treat the raw sewage. Additionally, package plant wastewater treatment systems go through three different stages when they treat wastewater. At first, the liquid enters a pre-treatment chamber where the waste is separated into layers. Next, the aerobic bacteria and the scum are converted into simple compounds, and the heavier solids, as well as the effluent, move to the aeration chamber for more processing. If you would like to know more about package plant wastewater systems and how our highly proficient team manages package plant installations, please [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today. We have performed many **package plant installations** up to this point and guarantee your complete satisfaction. --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), [Dade City](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), **[Odessa](/package-plant-installations-odessa-fl/)**, [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Package Plant Installations, Miami, FL](https://southernsepticanddesign.com/package-plant-installations-miami-fl/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## We are your number one resource for wastewater solutions at your package plant installations in Miami. ![Package Plant Installations in Miami, Florida](/wp-content/uploads/2016/10/2012-10-22-09.56.16-resized1-300x180.jpg)When it comes to large-scale wastewater systems, at Southern Water and Soil, we have extensive knowledge of a number of solutions that can help you with **package plant installations** in Miami, FL. Not only do we research development site codes, but we also keep up with the latest technologies and work to ensure your package plant installations function as they should. Our team at Southern Water and Soil is fully licensed, bonded and insured. When you work with us, you can expect accurate quotes and proposals that take into account all of the factors at your development site. As experts in package plant installations, we will work as a team to ensure that your wastewater system aligns with local codes and regulations and you can see first-hand the benefits of working with us. We are dedicated to an informative approach partner with top manufacturers so you can feel confident your commercial septic system is of the highest quality. When you choose to work with us, we take into account material costs, the type of commercial septic system you need, and your total budget. We won’t leave you guessing about the results of your package plant installations or the best maintenance and care options. We are your number one resource for wastewater solutions at your **package plant installations** in Miami. With over three decades of experience in commercial wastewater treatment systems, our team at Southern Water and Soil is equipped to handle the design and installation of your wastewater system from beginning to end. [Contact us](/contact-southern-water-and-soil/) today to get started. --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), [Dade City](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [**Miami**](/package-plant-installations-miami-nc/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Package Plant Installations, Lutz, FL](https://southernsepticanddesign.com/package-plant-installations-lutz-fl/) **Published:** February 22, 2016 **Author:** Southern Water Soil **Content:** ## When we work on package plant installations in Lutz, FL, we ensure that our client knows exactly how their new system will work after it is set up. ![Package Plant Installations](/wp-content/uploads/2016/02/51-resized-300x180.jpg)Residences and businesses in Lutz, Florida that do not rely on the municipal water system typically use a septic system to manage the wastewater treatment process. While septic systems come with many advantages, not every property can benefit from using one of these systems. When this occurs, at Southern Water and Soil, we often recommend the use of a package plant. Thanks to our three decades of experience working on **package plant installations**, we know you will be more than happy with our workmanship. When we work on package plant installations, we ensure that our client knows exactly how their new system will work after it is set up. These systems come with a multi-chamber tank and are different than regular septic systems because a digestive process is used to treat the wastewater and raw sewage. It is important to remember that these systems also go through three different stages when they treat wastewater. During the first stage, the sewage travels into a chamber where oils, grease, and lighter waste rise to the top and heavier solids sink to the bottom. Second, the scum and the liquid are combined with oxygen, and simple compounds are formed after the aerobic bacteria start to work. Third and finally, the solid waste and the liquid layer are separated and eventually returned for processing to the aeration chamber. If you would like to know more about **package plant installations** and our team’s role in the process, please [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today. We look forward to hearing from you! --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), [Dade City](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), **[Lutz](/package-plant-installations-lutz-fl/)**, [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Package Plant Installations, Land O’ Lakes, FL](https://southernsepticanddesign.com/package-plant-installations-land-o-lakes-fl/) **Published:** June 7, 2016 **Author:** Southern Water Soil **Content:** ## We are committed to your satisfaction during package plant installations, and our team works to exceed customer expectations in Land O’ Lakes. ![Package Plant Installations in Land O’ Lakes, Florida](/wp-content/uploads/2016/06/2012-10-22-09.56.16_resized-300x179.jpg)Are you building a new package plant and you need a company that can assist with the wastewater portion of your development site? If you have been looking for a company with experience with **package plant installations**, you have come to the right place at Southern Water and Soil. We have over three decades of experience assisting developers with their large-scale wastewater installations, and we will ensure your package plant installations function exactly like you need them to. With our extensive knowledge of site development codes and use of the latest technologies, we will ensure your package plant installation goes smoothly. We can design, install and maintain your commercial septic system when other companies may not have the ability. When you work with us, you will find that we: - Are fully licensed, bonded, and insured - Provide accurate quotes and proposals, taking into account all factors at your site - Are experts at package plant installations that meet the requirements set by local authorities - Are dedicated to an informative approach for our clients, so they see the benefits of working with us - Have partnered with top manufacturers to ensure your system is of the highest quality When you work with us at Southern Water and Soil for professional **package plant installations** in Land O’ Lakes, Florida, we take into account material costs, the type of system you need installed, and the cost and budget required. We are committed to your satisfaction, and our team works to exceed customer expectations. [Contact us](/contact-southern-water-and-soil/) today to learn more about how we can assist with package plant installations at your development site. --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), [Dade City](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), **[Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/)**, [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Package Plant Installations, Fort Myers, FL](https://southernsepticanddesign.com/package-plant-installations-fort-myers-fl/) **Published:** July 11, 2016 **Author:** Southern Water Soil **Content:** ## Our process for package plant installations in Fort Myers has been refined over and over again. ![Package Plant Installations in Fort Myers, Florida](/wp-content/uploads/2016/07/2012-10-22-09.56.16-resized-300x180.jpg)Septic systems are used by commercial and residential locations in the Fort Myers, Florida area that are not hooked up to the municipal wastewater system. While septic systems are usually an alternative to using the city’s system, in some cases, a property’s features do not make it a good candidate to use septic. When this happens, at Southern Water and Soil, we often recommend the installation of a package plant. With over three decades of experience working on **package plant installations**, we guarantee complete customer satisfaction. When you allow us to install one of these systems on your property, we will make sure you understand how your new wastewater treatment system will work. Compared with traditional septic systems, these systems treat raw sewage using an aerobic digestive process, and they do so in three separate stages. When our team works on package plant installations, we only use products we know and trust. More specifically, we use Orenco systems because of their proven ability to treat wastewater effectively and because these systems boast an unparalleled level of quality. Our process for **package plant installations** has been refined over and over again, and we are confident you can benefit from our experience. For more information about the products we use, whether your property is a good fit for a package plant, or why you should work with us, [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today. --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), Dade City, [**Fort Myers**](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Package Plant Installations, Florida](https://southernsepticanddesign.com/package-plant-installations-florida/) **Published:** March 20, 2024 **Author:** Southern Water Soil **Content:** ## Custom-built, our plants use the latest treatment technology. ![Package Plant Installations in Florida](/wp-content/uploads/2021/04/51-300x179.jpg)As a commercial property or industry in **Florida**, effectively treating wastewater onsite is necessary for smooth operations and regulatory compliance. However, designing, installing, and maintaining an efficient package plant alone can be a major hassle. For over 30 years, we have been a trusted partner for turnkey package plant installations sized for the unique needs of commercial clients. Custom-built, our plants use the latest treatment technology to process high volumes of wastewater sustainably. We expertly design and build self-contained wastewater treatment facilities and deliver them as a complete working unit to handle your wastewater treatment demands. We size them based on your facility’s specific hydraulic and pollutant loads, and this customization and ease of package plant installation make them an attractive choice for commercial wastewater treatment. Our trained engineers survey your space and specifications to design a robust, efficient plant that meets all operational requirements. We take care of permitting and seamless onsite **package plant installations** with minimal disruption to your business. We can also provide regular component checks, cleaning, repairs, testing, and more to prevent issues. Our team stays current on all compliance regulations and handles renewals and reporting to keep your business legally compliant. At Southern Water and Soil, we leverage cutting-edge biological and mechanical treatment solutions. Our customized designs focus on removing harsh contaminants so the treated effluent can be reused for irrigation, vehicle washing, and other industrial applications. Our specialists make **package plant installations** hassle-free while saving you money in the long term. [Contact us today](/contact-southern-water-and-soil/) to get your project started. --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), [Dade City](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), **[Florida](/package-plant-installations-florida/)**.* ### Similar Services We Offer: --- ### [Package Plant Installations, Dade City, FL](https://southernsepticanddesign.com/package-plant-installations-dade-city-fl/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## Our team has over three decades of experience performing package plant installations in Dade City, FL and is committed to your complete satisfaction. ![Package Plant Installations in Dade City, Florida](/wp-content/uploads/2016/02/51-resized-300x180.jpg)Businesses or residences that are not connected to the municipal water system generally rely on a septic system for their wastewater treatment needs. However, not every property is a good candidate for a septic system. In cases like these, at Southern Water and Soil, we may recommend a package treatment plant to treat wastewater on your property. Our team has over three decades of experience performing **package plant installations** in **Dade City, Florida** and is committed to your complete satisfaction. Before we perform package plant installations, we make sure that our client is fully aware of how their new system will function. To give you a better feel for how these systems work, package treatment plants come with a multi-chamber tank. This is different than traditional septic systems because package treatment plants use an aerobic digestive process to treat the raw sewage. Package wastewater treatment systems also treat wastewater in three different stages. During the first stage, the sewage enters a pre-treatment chamber where heavy solids sink to the bottom, and lighter waste, like oils and grease, remain at the top. Second, the liquid mixture and the scum are mixed with oxygen, and aerobic bacteria reduce the sewage into simple compounds. Finally, the heavier solids and the effluent are separated in the clarification chamber and are returned to the aeration chamber for additional processing. The leftover clarified liquid is then transported to the environment for disposal. When our team performs **package plant installations**, we use Orenco and Norweco products. One of the main reasons why we have formed a partnership with this leading manufacturers of wastewater treatment products is because they offer top of the line systems for municipal areas to the single family home. If you would like to find out more about package plant systems, how they work, and why they are a beneficial wastewater treatment option, [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil. We look forward to hearing from you! --- *At Southern Water and Soil, we offer **package plant installations** in [Brooksville](/package-plant-installations-brooksville-fl/), [**Dade City**](/package-plant-installations-dade-city-fl/), [Fort Myers](/package-plant-installations-fort-myers-fl/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/), [Lutz](/package-plant-installations-lutz-fl/), [Miami](/package-plant-installations-miami-fl/), [Odessa](/package-plant-installations-odessa-fl/), [Orlando](/package-plant-installations-orlando-fl/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/), and [Tampa](/package-plant-installations-tampa-fl/), [Florida](/package-plant-installations-florida/).* ### Similar Services We Offer: --- ### [Septic System Inspections, Tampa, FL](https://southernsepticanddesign.com/septic-inspections-tampa-fl/septic-system-inspections/) **Published:** September 1, 2024 **Author:** Southern Water Soil **Content:** ## Rely on our team for a thorough septic system inspection. Scheduling regular **septic system inspections** is crucial if your residential or commercial property has a private septic tank. Without timely maintenance and repairs, you could face expensive fixes, sewage backups, and a wide range of other unpleasant problems. If you can’t recall the last time a professional evaluated your septic system, our team at Southern Water and Soil strongly urges you to give us a call. ![Septic System Inspections in Tampa, Florida](/wp-content/uploads/2023/04/Xq8uAYl4-res.jpeg) For over 30 years, our dedicated local professionals have been providing reliable septic services for residential and commercial clients throughout the **Tampa, Florida** community. Our highly skilled and knowledgeable septic contractors are well-equipped to offer comprehensive solutions for our customers, from septic system inspections to drain field installations. We take pride in our work, and we strive to go above and beyond to deliver long-lasting solutions that people can rely on. During standard **septic system inspections**, our team will carefully assess each component of your septic system. This involves examining the septic tank itself, the drain field, and the connections between various parts of the system. We will take careful note of any areas of concern as we work, and once our inspection is complete, we’ll write up a report and relay our findings to you. Some people think that septic system inspections are only recommended before buying or selling a property, but the truth is that regular inspections can help extend the life of your system by catching small issues before they wreak havoc on your property. If you would like to learn more about septic system inspections or schedule an appointment, please [reach out](/contact-southern-water-and-soil/) to us today. --- *At Southern Water and Soil, we perform **septic system inspections** in [Brooksville](/septic-inspections-brooksville-fl/septic-system-inspections/), [Dade City](/septic-inspections-dade-city-fl/septic-system-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/septic-inspections-spring-hill-fl/septic-system-inspections/), and [**Tampa**](/septic-inspections-tampa-fl/septic-system-inspections/), Florida.* --- ### [Drain Field Inspections, Tampa, FL](https://southernsepticanddesign.com/septic-inspections-tampa-fl/drain-field-inspections/) **Published:** September 1, 2024 **Author:** Southern Water Soil **Content:** ## We conduct thorough drain field inspections to ensure your peace of mind. Drain fields are crucial components in septic systems throughout the **Tampa, Florida** region. If you have a private septic system on your residential or commercial property, you probably know that your drain field is the last stage of the wastewater treatment process, so it’s crucial to keep this component working properly. An overflowing or malfunctioning drain field can lead to a wide range of health risks, environmental hazards, and other troubling issues, which is why scheduling routine drain field inspections is strongly recommended. ![Drain Field Inspections in Tampa, Florida](/wp-content/uploads/2024/08/Real-Estate-Sale-Septic-Inspections.webp) Here at Southern Water and Soil, our knowledgeable septic contractors have been helping property owners keep their septic systems in good working order for over 30 years. Throughout our decades of experience, we have completed countless **drain field inspections**, and we would be honored to provide this service at your residential or commercial property. During this process, our team will carefully examine each part of your drain field to ensure that it is working effectively and efficiently. If you notice any unusual issues with your drain field or your septic system in general, we encourage you to contact us as soon as possible. Our skilled professionals will be able to diagnose the source of the issue quickly and come up with an effective solution before it can cause major damage to your home or landscape. However, even if you don’t notice any problems, it’s still a good idea to schedule **drain field inspections** once per year to keep everything running smoothly. For more information about drain field inspections and our process, please [reach out](/contact-southern-water-and-soil/) to our team today to schedule an appointment. --- *At Southern Water and Soil, we perform **drain field inspections** in [Brooksville](/septic-inspections-brooksville-fl/drain-field-inspections/), [Dade City](/septic-inspections-dade-city-fl/drain-field-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and **[Tampa](/septic-inspections-tampa-fl/drain-field-inspections/)**, Florida.* --- ### [Drain Field Inspections, Brooksville, FL](https://southernsepticanddesign.com/septic-inspections-brooksville-fl/drain-field-inspections/) **Published:** January 15, 2024 **Author:** Southern Water Soil **Content:** ## The best line of defense against costly issues is keeping up with regular drain field inspections. A problem with the drain field on your **Brooksville, Florida** property can lead to a number of issues. One of the most concerning problems associated with a damaged drain field is contamination, which can occur if water moves back into the soil without proper treatment. Other problems include backups, unpleasant odors, and damage to the surrounding landscape. However, since this component sits beneath the ground, it’s difficult to know when something isn’t functioning as it should be. The best line of defense against costly issues is keeping up with regular **drain field inspections**. ![Drain Field Inspections in Brooksville, Florida](/wp-content/uploads/2023/04/zpx1J1xQ-res.jpeg) Part of owning a property with a septic system is ensuring that every component is properly maintained. The septic tank needs to be pumped out regularly, and the drain field needs to be visually inspected. All of these tasks should be left in the hands of a skilled professional. At Southern Water and Soil, we have a team of experts who can take care of all your septic needs, including performing regular drain field inspections. We recommend scheduling this service approximately once per year, although our technicians can come to your property sooner if you notice warning signs of problems. These may include bright green or spongy patches of grass, puddles of standing water, and unpleasant smells in the air. With years of experience in the septic industry, we’re the team to trust for **drain field inspections**. We can pinpoint and address concerns, ensuring that your system continues to function as it should and protecting your property from damage. [Contact our team](/contact-southern-water-and-soil/) today to learn more or to schedule your next inspection. --- *At Southern Water and Soil, we perform **drain field inspections** in [**Brooksville**](/septic-inspections-brooksville-fl/drain-field-inspections/), [Dade City](/septic-inspections-dade-city-fl/drain-field-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Spring Hill, and [Tampa](/septic-inspections-tampa-fl/drain-field-inspections/), Florida.* --- ### [Septic System Inspections, Spring Hill, FL](https://southernsepticanddesign.com/septic-inspections-spring-hill-fl/septic-system-inspections/) **Published:** June 10, 2024 **Author:** Southern Water Soil **Content:** ## Our experienced inspectors will ensure that your septic system remains in great condition. Scheduling regular septic system inspections is something that many property owners can overlook here in the **Spring Hill, Florida** area. With so many other home and commercial maintenance tasks to take care of, it can be easy to forget about inspecting a system that’s mostly concealed underground. However, if you want to ensure that your septic system works reliably and lasts as long as possible, our team at Southern Water and Soil highly recommends scheduling routine septic system inspections. ![Septic System Inspections in Spring Hill, Florida](/wp-content/uploads/2023/04/Xq8uAYl4-res.jpeg) Our comprehensive **septic system inspections** are designed to thoroughly examine all the critical components throughout your system to identify any potential issues. Our skilled and experienced professionals will inspect your septic tank, pipes, drain field, and other key areas to determine the overall health of your system. Some people wonder why they should schedule **septic system inspections** if they aren’t experiencing any issues with their systems. However, there are a few noticeable advantages of getting routine septic system inspections, such as: - **Early Detection**: When you get regular inspections, it’s easier to find small issues before they have the chance to evolve into more serious (and expensive) problems. - **Remain Compliant**: If you own a commercial property, it may be required to get regular septic system inspections to ensure that your facilities are safe and sanitary. - **Peace of Mind**: Routine septic system inspections can give you peace of mind about the reliability and functionality of this essential system. Don’t wait until problems arise to schedule a professional inspection with our team. [Contact our skilled professionals today](/contact-southern-water-and-soil/) to learn more about our services or schedule a consultation. --- *At Southern Water and Soil, we perform **septic system inspections** in [Brooksville](/septic-inspections-brooksville-fl/septic-system-inspections/), [Dade City](/septic-inspections-dade-city-fl/septic-system-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, **[Spring Hill](/septic-inspections-spring-hill-fl/septic-system-inspections/)**, and [Tampa](/septic-inspections-tampa-fl/septic-system-inspections/), Florida.* --- ### [Septic System Inspections, Brooksville, FL](https://southernsepticanddesign.com/septic-inspections-brooksville-fl/septic-system-inspections/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## We can inspect your septic system for ongoing and potential issues. Designed to dispose of and treat wastewater, septic systems are common here in the **Brooksville, Florida** area. If your property relies on a septic system to dispose of and manage wastewater, it is imperative that you have a professional inspect it regularly to catch issues early on, so that there is less of a chance that they evolve into major issues. ![Septic System Inspections in Brooksville, Florida](/wp-content/uploads/2023/04/Xq8uAYl4-res.jpeg) If you are looking for a company in the area that performs thorough, comprehensive **septic system inspections**, turn to us at Southern Water and Soil. We have years of experience working with septic systems, and we are known for our high-quality customer service and excellent workmanship. We suggest that at the very least, you have your septic system inspected every few years. This will give us the opportunity to identify any existing and potential issues. As a result, this can prevent major and costly repairs. We also recommend having an inspection done on a property before you purchase it. For example, having a professional inspection done prior to the purchase of a home with a septic system can ensure you do not end up buying a home with major septic issues. We are extremely thorough when providing septic system inspections and provide full reports at the completion of each appointment. To learn more about what’s included in our **septic system inspections** or to schedule your next inspection, don’t hesitate to [contact our experienced team](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we perform **septic system inspections** in [**Brooksville**](/septic-inspections-brooksville-fl/septic-system-inspections/), [Dade City](/septic-inspections-dade-city-fl/septic-system-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, [Spring Hill](/septic-inspections-spring-hill-fl/septic-system-inspections/), and [Tampa](/septic-inspections-tampa-fl/septic-system-inspections/), Florida.* ### Similar Services We Offer: --- ### [Drain Field Design, Brooksville, FL](https://southernsepticanddesign.com/commercial-septic-brooksville-fl/commercial-septic-drain-field/drain-field-design/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## Proper drain field design can increase your system’s longevity and reduce the risk of contamination. The drain field is an often overlooked but critical component of a septic system that ensures its optimal operation. A correctly constructed drain field is not only necessary, but it may have a substantial impact on the longevity and performance of the system as a whole. With over 30 years of experience in the septic industry, you can trust our team at Southern Water and Soil to provide you with a precise and efficient **drain field design** in the **Brooksville, Florida** area. ![Drain Field Design in Brooksville, Florida](/wp-content/uploads/2017/03/Drain-Field-Design-1.jpg) The drain field is essential in the final stage of wastewater treatment in a septic system. After the sediments are separated in the septic tank, the liquid effluent is pumped into the drain field for further filtration and treatment. Proper drain field design ensures that this process works as it should, allowing the soil to naturally filter out hazardous bacteria, viruses, and pollutants before the cleansed water percolates into the groundwater. Improperly built drain fields can contaminate local water sources, such as wells or surface water bodies. This contamination can occur if the effluent is not properly processed or if it bypasses the soil filtering process due to design defects such as an insufficient absorption area or an incorrect slope. Precise drain field design reduces these risks by ensuring that effluent is sufficiently purified before reaching groundwater reserves. Additionally, a properly designed and built drain field can considerably extend the life of your septic system. The right design decreases the chance of premature system failure by dispersing wastewater equally across the absorption region, providing suitable soil depth and type, and keeping an appropriate distance from water sources. As a result, you avoid costly future repairs and replacements. If you need **drain field design** in the Brooksville area, [reach out to a member](/contact-southern-water-and-soil/) of our team today to see how we can help. --- *At Southern Water and Soil, we offer **drain field design** services in [**Brooksville**](/commercial-septic-brooksville-fl/commercial-septic-drain-field/drain-field-design/), [Dade City](/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-design/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-design/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-design/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-design/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-design/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-design/), Florida.* --- ### [Drain Field Design, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-design/) **Published:** January 15, 2024 **Author:** Southern Water Soil **Content:** ## Our drain field design services are handled by highly skilled and trained professionals. Before a septic system can be installed on a property, the various components must be designed based on the layout and needs of the structure. One of the most critical components found within this type of self-contained waste storage and processing system is the drain field, which is where treated effluent (or wastewater) goes after moving through the septic tank. The **drain field design** depends on the amount of space available on the property, as well as the elevation and slope, soil conditions, and any regulations in place in the area. ![Drain Field Design in Spring Hill, Florida](/wp-content/uploads/2017/03/Drain-Field-Design-1.jpg) Property owners in and near **Spring Hill, Florida** can count on our knowledgeable team at Southern Water and Soil to handle their drain field design and other septic needs. We work with both residential and commercial clients located throughout the area, applying decades of experience to every project we tackle. Before embarking on a septic installation task, we take the time to design every component, pull any necessary permits, and ensure that each step is completed properly. Even missing one aspect of the process could result in a septic system that clogs regularly or allows potentially contaminated liquid waste to move into the soil on the property. Our **drain field design** services are handled by highly skilled and trained professionals. We assess the layout and grade of the land to ensure the best possible placement of each component. You can trust that we will complete the job right from start to finish, as well as take care of the future maintenance needs to keep things flowing smoothly. [Contact us](/contact-southern-water-and-soil/) today to learn more or get started with an estimate for service. --- *At Southern Water and Soil, we offer **drain field design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/drain-field-design/), [Dade City](/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-design/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-design/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-design/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-design/), Orlando, Plant City, Wesley Chapel, [**Spring Hill**](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-design/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-design/), Florida.* --- ### [Drain Field Design, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-drain-field/drain-field-design/) **Published:** January 21, 2016 **Author:** Southern Water Soil **Content:** ## You can count on our expertly trained septic engineers to handle your drain field design project in Lutz, FL. ![Drain Field Design, Lutz, FL](/wp-content/uploads/2016/01/2011-02-22-17.55.54-300x179.jpg)One of the most important components in ensuring that your septic system works properly is drain field design. The drain field is one of two main parts of the system; the second is the septic tank. The septic tank is where wastewater goes after it leaves your building and where the first stage of processing occurs. Solid waste is separated from water, and the water then flows into the drain field. The drain field is where the wastewater is filtered for a second time, often with the help of certain chemicals, before being released back into the environment. Proper **drain field design** is essential to making sure that the water flows correctly through the system and ensuring that the drain field is long enough to give the water time to filter. There are three main factors that go into drain field design: - **Size**—The size of the septic tank and drain field will be determined by the size of the property (and number of bathrooms). - **Location**—The drain field must be installed at the proper elevation so water will flow properly from the tank. - **Soil**—Certain soil conditions are needed to enable proper filtration of water. Because the drain field is such an essential part of any septic system, it is imperative that it be designed and installed correctly. If you find yourself in need of custom **drain field design** services in Lutz, FL, you can’t do better than Southern Water and Soil. We are experts in the septic industry and have trained engineers on hand to tackle your project. Just [give us a call](/contact-southern-water-and-soil/) for a free quote or to schedule an appointment. --- *At Southern Water and Soil, we offer **drain field design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/drain-field-design/), [Dade City](/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-design/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-design/), **[Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-design/)**, Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-design/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-design/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-design/), Florida.* --- ### [Drain Field Design, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-drain-field/drain-field-design/) **Published:** May 12, 2016 **Author:** Southern Water Soil **Content:** ## We handle all of your drain field design needs in Land O’ Lakes, from determining the right size to creating the perfect trench line. ![Drain Field Design in Land O’ Lakes, Florida](/wp-content/uploads/2016/05/Drain-Field-Design-300x225.jpg)If you are installing a new septic system, you will need to install a new septic drain field. You can’t just randomly install a drain field, though. You need to design it first. This is more advanced than you might think. If you let our team at Southern Water and Soil take the lead, we can handle every aspect of designing your septic drain field, from determining the size down to choosing the trench line. Let’s look at some of the different design components, so you can understand why a properly designed drain field is so important. Then, you will see why we are the company of choice for **drain field design**. When it comes to designing a drain field in Land O’ Lakes, Florida, the size is very important. We start by determining the soil percolation rate. If you own a three-bedroom home on a lot with a good percolation rate, you likely need a drain field that’s about 4,500 square feet. On the other hand, if your percolation rate is poor, you might need double that. We will test your percolation rate so your drain field can accommodate your needs. Otherwise, your drain field will back up at inopportune times, and we will have to come out and fix it. This is one of the most important drain field design elements. We also put a lot of our focus into designing a proper trench line. While we typically use perforated pipes that we bury in a trench that’s filled with gravel, we have to access the area to make sure that is the best option. We also need to decide if the drain field pipe hole should be up or down, and we need to determine the trench piping slope specifications. Everything must be done perfectly, which is why we take our time during the **drain field design** process. These are just two of the factors we assess when designing a septic drain field. [Contact us](/contact-southern-water-and-soil/) today so we can take over the project. That way, you can have peace of mind and a properly functioning drain field. --- *At Southern Water and Soil, we offer **drain field design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/drain-field-design/), [Dade City](/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-design/), Fort Myers, **[Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-design/)**, [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-design/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-design/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-design/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-design/), Florida.* --- ### [Drain Field Design, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-design/) **Published:** March 29, 2017 **Author:** Southern Water Soil **Content:** ## With our drain field design services, we provide a complete assessment of your property and will discuss your goals for your site in Dade City. ![drain-field-design](/wp-content/uploads/2017/03/Drain-Field-Design-1.jpg)There are a number of factors involved in drain field design, including the location, the soil type, and the size of the drain field needed to provide the best results. At Southern Water and Soil, we have the skills and experience to ensure that you achieve the most from your septic system with a **drain field design** that is ideal for your property in Dade City, Florida. Not only will we ensure that your drain field is designed to provide long-term usage, but we’ll also make sure the various components used during installation are equipped to provide long-lasting results. With our drain field design services, we will provide a complete assessment of your property, as well as discuss your overall goals for your site before installation. If your current drain field design is not working well for your needs, we can reconfigure this part of your septic system to provide better outcomes. If you are building a new facility at your site and want to set yourself up for success long-term, we’ll provide expert drain field design services that don’t leave you guessing about the quality of your drain field or your septic system overall. At Southern Water and Soil, our experienced team has decades of experience in decentralized wastewater treatment systems, as well as knowledge about how to best preserve and protect the water resources near your site. You won’t be disappointed when you work with our team on **drain field design** and installation. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today if you have questions about drain field design or you would like our highly skilled team to provide an assessment of your property before installation. --- *At Southern Water and Soil, we offer **drain field design** services in [Brooksville](/commercial-septic-brooksville-fl/commercial-septic-drain-field/drain-field-design/), **[Dade City](/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-design/)**, Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-design/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-design/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-design/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-design/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-design/), Florida.* --- ### [Engineered Drip Septic Systems, Miami, FL](https://southernsepticanddesign.com/residential-septic-miami-fl/septic-engineering/engineered-drip-septic-systems/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## Drip septic systems are ideal for controlling environmental impact on surrounding soil. Septic systems are more complex than many people may suspect, and they also come with more variety by way of different technological advancements. **Engineered drip septic systems**, for example, take advantage of a technique that limits how fast waste goes through the soil. This control lessens the risk of contaminating groundwater, which is more environmentally conscious than septic systems with a larger flow and less control. ![Engineered Drip Septic Systems in Miami, Florida](/wp-content/uploads/2024/07/20130824_131413res.jpg) Like with other septic systems, engineered drip septic systems are the product of hard work, expertise in modern septic advancements, and quality workmanship. You can expect all three of these factors from our team here at Southern Water and Soil. We pride ourselves on staying up to date with what septic system technology is out there and how these different technologies will benefit our clients here in the **Miami, Florida** area. The key to reliability and maximizing the benefits of your septic system is working with a septic company that understands everything there is to know about installing and maintaining the best systems available. **Engineered drip septic systems** are some of the best septic systems out there for a wide range of reasons, and they’re perfect for property owners looking for safe and efficient waste management that minimizes their environmental impact. We recommend these systems to clients who want more control over their waste management, and if you decide that this type of septic system is right for your needs, we’d be happy to work with you to design and implement this system on your property. [Call us today](/contact-southern-water-and-soil/) if you need engineered septic services for your commercial or residential property. --- *At Southern Water and Soil, we install **engineered drip septic systems** in Brooksville, [Dade City](/residential-septic-services-dade-city-fl/septic-engineering/engineered-drip-septic-systems/), Fort Myers, Land O’ Lakes, Lutz, [**Miami**](/residential-septic-miami-fl/septic-engineering/engineered-drip-septic-systems/), Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/residential-septic-tampa-fl/septic-engineering/engineered-drip-septic-systems/), [Florida](/residential-septic-florida/septic-engineering/engineered-drip-septic-systems/).* --- ### [Septic Services, Brooksville, FL](https://southernsepticanddesign.com/septic-services-brooksville-fl/) **Published:** July 17, 2024 **Author:** Southern Water Soil **Content:** ## We offer a variety of septic services in the Brooksville area. ![Septic Services in Brooksville, Florida](/wp-content/uploads/2016/08/2012-11-20-12.45-resize-300x169.jpg)Maintaining a septic system is critical to the proper operation of any property that relies on it. The septic system is essential for efficient wastewater management in both residential and business settings. While dealing with septic difficulties on your own may seem simple, hiring an experienced team like us at Southern Water and Soil ensures your system gets the **septic services** it needs to continue working to its full potential. The truth is that septic systems are complex and require specific knowledge for proper installation, maintenance, and repair. Our team understands the complexities of many systems, ranging from traditional to alternative designs. As such, we can precisely detect problems, offer appropriate solutions, and carry out repairs efficiently, ensuring your system runs smoothly. Also, septic system installation and maintenance are subject to local legislation and environmental norms. We keep up to date with any changes to these requirements and ensure that all work complies with local rules and regulations. We can also guide you through the permits from beginning to end, saving you a lot of frustration and giving you peace of mind. We also have the specialized tools and equipment needed for septic services, allowing us to complete our jobs with efficiency and precision. This results in faster resolutions and less interruption to your property, which is critical if you own a commercial property or if you’re on a tight deadline. If you need assistance with **septic services**, hiring an experienced team like us just makes sense. [Contact us](/contact-southern-water-and-soil/) today to learn more about the services we offer in the **Brooksville, Florida** area. --- *At Southern Water and Soil, we offer **septic services** in [**Brooksville**](/septic-services-brooksville-fl/), [Dade City](/septic-services-brandon/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-services-odessa-fl/), Orlando, Plant City, [Spring Hill](/septic-services-spring-hill-fl/), and [Tampa](/septic-services-tampa-fl), Florida.* --- ### [Septic Services, Tampa, FL](https://southernsepticanddesign.com/septic-services-tampa-fl/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Content:** ## Call us today to learn how our septic services in Tampa, FL can benefit you. ![Septic Services, Tampa, FL](/wp-content/uploads/2014/07/2012-01-18-13.31.18-300x179.jpg)If you have a septic system, it is most likely one of two main types: gravity-fed or alternative. An alternative system has a pump, which helps move liquid and solid waste and water through the pipes, out of the home or office building and into the tank. Various items that we use in our homes and offices can clog the pipes, so if you do have a septic system, use caution when flushing items down the drains. If your pump is not able to clear a clog, we can bring out a pump truck to use stronger force to move the clog and relieve pressure on the pipes. If a clog is left untreated, it will cause water and waste to back up and possibly come into your home or office. Watch for potential signs of clogs, such as slow-draining sinks or showers, higher water levels in the toilet, or even water coming up through floor drains. If you do have a problem with a pump in your septic system, we can help with pump repair or replacement. This is just one of the many **septic services** that we offer to those in the Tampa area, and our experienced technicians can remove clogs safely and effectively. At Southern Water & Soil, we offer **septic services** to residential and commercial properties in Tampa, Florida, as well as surrounding cities, including Zephyrhills, Lutz, Dade City, Brandon, Plant City, Odessa, and Land O Lakes. Call us today to learn how our septic services can benefit you. --- *At Southern Water and Soil, we offer **septic services** in [Brooksville](/septic-services-brooksville-fl/), [Dade City](/septic-services-brandon/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-services-odessa-fl/), Orlando, Plant City, [Spring Hill](/septic-services-spring-hill-fl/), and **[Tampa](/septic-services-tampa-fl)**, Florida.* --- ### [Septic Services, Spring Hill, FL](https://southernsepticanddesign.com/septic-services-spring-hill-fl/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## We offer a comprehensive range of septic services to keep your system in good working order. Maintaining a home, business, or other property is a big job, and very few people can do it by themselves. Fortunately, no one expects you to do everything yourself, and in fact, there are some jobs you shouldn’t even attempt to do on your own. For example, you should let professional septic technicians like those on our team at Southern Water and Soil take care of your septic system. We have over 30 years of experience in the industry, and we offer a comprehensive range of **septic services**, so you can count on us to get the job done right. ![Septic Services in Spring Hill, Florida](/wp-content/uploads/2023/12/2012-11-20-12.45.25-res.jpg) Whether you need septic services for your residential or commercial property, we’ve got you covered. Our team has the right knowledge and experience to design and build new septic systems, as well as to pump, maintain, and repair existing ones. You can count on us to keep your system in optimal condition, so if you ever have an issue or just want someone to take a look to make sure everything’s okay, feel free to give us a call. We’ll assess your system and give it any service it might require, returning it to like-new condition. Our team is proud to serve the community here in **Spring Hill, Florida**, and you can count on us to keep your septic system in good working order. If you need **septic services** of any kind, please do not hesitate to [give us a call](/contact-southern-water-and-soil/) to get our experts on the job right away. --- *At Southern Water and Soil, we offer **septic services** in [Brooksville](/septic-services-brooksville-fl/), [Dade City](/septic-services-brandon/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-services-odessa-fl/), Orlando, Plant City, [**Spring Hill**](/septic-services-spring-hill-fl/), and [Tampa](/septic-services-tampa-fl), Florida.* --- ### [Septic Services, Odessa, FL](https://southernsepticanddesign.com/septic-services-odessa-fl/) **Published:** July 25, 2015 **Author:** Southern Water Soil **Content:** ## Our septic services in Odessa, FL aim to keep your septic system healthy and fully functioning for many years. **![Septic Services, Odessa, FL](/wp-content/uploads/2015/06/DSC00177-1-300x224.jpg)Septic services** are not limited to the major reasons people need professional help with their septic systems. Beyond standard cleaning and emptying, there are a number of septic services that aim to keep your septic system healthy and fully functioning for many years. Our team at Southern Water and Soil is here to help all of our customers with a variety of septic services, including permitting, repair, and the full spectrum of installation and maintenance needed to keep your system functioning at its best. If your location has never had a septic system, or if you are planning changes or expansion of an existing system, you will need to know the local, state, and federal regulations regarding septic systems. Various rules exist in certain areas in order to protect groundwater resources, preserve soil integrity, and ensure that septic systems conform to standards of hygiene and public health. Working with someone who already knows the permitting process will greatly speed up the approval of your permit application, avoiding potential issues in the design and implementation of a septic system that could require a redesign of the entire setup or a flat-out rejection of the application. Knowing the types and options available to your area allows you to customize your septic system to your needs, ensuring that you will have a worry-free setup that will be reliable for many years. If you do have any problems that arise, your first call will be to a company you can trust to do the best work in the least amount of time for the best price. At Southern Water and Soil, we have years of experience in the **Odessa, Florida** area, the best products for your septic system, and the commitment to all of our customers with our **septic services**. --- *At Southern Water and Soil, we offer **septic services** in [Brooksville](/septic-services-brooksville-fl/), [Dade City](/septic-services-brandon/), Fort Myers, Land O’ Lakes, Lutz, Miami, **[Odessa](/septic-services-odessa-fl/)**, Orlando, Plant City, [Spring Hill](/septic-services-spring-hill-fl/), and [Tampa](/septic-services-tampa-fl), Florida.* --- ### [Septic Services, Dade City, FL](https://southernsepticanddesign.com/septic-services-dade-city-fl/) **Published:** August 15, 2016 **Author:** Southern Water Soil **Content:** ## Contact us at Southern Water and Soil today for septic services at your home or commercial property in Dade City. ![Septic Services in Dade City, Florida](/wp-content/uploads/2016/08/2012-11-20-12.45-resize.jpg)When you need **septic services** in Dade City, Florida, you don’t want to call just anyone. When it comes to your septic system, you want a company that is reputable, experienced, and knowledgeable about everything that has to do with keeping your septic system in good working order. At Southern Water and Soil, we are your first choice when you need septic services because we provide a range of services and have the expertise to meet your needs. - **Commercial** – When it comes to commercial septic system engineering, there is no better team for the job than ours at Southern Water and Soil. We understand that commercial septic services require a different approach than residential systems, and we are prepared to assist you with everything from design to installation and maintenance. - **Residential** – At Southern Water and Soil, we believe septic services are more than just cleaning your tank. Our experienced and knowledgeable staff can assist with your every need, including designing and installing a system that is perfect for your home or performing a real estate septic inspections when you are buying or selling a home. At Southern Water and Soil, we offer septic system warranty packages, expert drainage system design and installation, and can even discuss your needs if you own and operate a package plant. We have the tools and experience to meet your needs. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today for **septic services** at your home or commercial property in Dade City. We are ready to assist you! --- *At Southern Water and Soil, we offer **septic services** in [Brooksville](/septic-services-brooksville-fl/), **[Dade City](/septic-services-brandon/)**, Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-services-odessa-fl/), Orlando, Plant City, [Spring Hill](/septic-services-spring-hill-fl/), and [Tampa](/septic-services-tampa-fl), Florida.* --- ### [Effluent Sewers, Spring Hill, FL](https://southernsepticanddesign.com/package-plant-installations-spring-hill-fl/effluent-sewers/) **Published:** May 5, 2024 **Author:** Southern Water Soil **Content:** ## You can count on us to create the ideal effluent sewer systems for your community. ![Effluent Sewers in Spring Hill, Florida](/wp-content/uploads/2016/10/88014103-septic-tank-design-resized-199x300.jpg)At Southern Water and Soil, we have extensive experience in the wastewater management field. Our team has been working in this industry for over 30 years, and we have completed countless projects in that time, designing systems for housing developments, office parks, and much more. In our experience, different communities require different solutions for wastewater and septic management—for instance, large cities typically have widespread water treatment infrastructure already in place, but smaller communities require a different approach. For small and medium-sized communities, we frequently use **effluent sewers**. Traditional sewers rely on gravity to keep water and waste moving through the pipes, but effluent sewers use pumps instead. In addition, effluent sewers trap solid waste in septic tanks (larger than the ones used for private homes) while allowing liquids to continue on for further treatment. By the time the liquid effluent has passed through all the filters and treatment infrastructure in our effluent sewer systems, it will be clean enough to be used for irrigation. This means you can make use of the graywater to water your community’s landscaping, keeping your whole neighborhood looking its best. Our team has the right experience to take care of every step of the process to install effluent sewers in your community, from initial designs and permitting to the final installation and cleanup. We are confident that you will be more than satisfied with our results. If you are interested in installing **effluent sewers** in your **Spring Hill, Florida**, community, simply [give us a call](/contact-southern-water-and-soil/) to find out how to get started. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), [Miami](/package-plant-installations-miami-fl/effluent-sewers/), [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [**Spring Hill**](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Tampa, FL](https://southernsepticanddesign.com/package-plant-installations-tampa-fl/effluent-sewers/) **Published:** February 17, 2016 **Author:** Southern Water Soil **Content:** ## Effluent sewers are often a good choice for the wastewater collection and treatment needs of small communities and new subdivisions in Tampa, FL. ![Effluent Sewers](/wp-content/uploads/2016/02/88014103-septic-tank-design-199x300.jpg)Hundreds of communities throughout Tampa, Florida and America successfully collect and treat wastewater with an effluent sewer system. At Southern Water and Soil, we recognize that **effluent sewers** are becoming recognized as the best solution for small to mid-sized communities, environmentally sensitive locations, and new subdivisions in terms of wastewater collection and treatment because they cost much less than conventional gravity sewers. Additionally, when effluent sewers are properly designed, the effluent produced can be re-used for irrigation purposes, and they are extremely easy to maintain. We are proud of our ability to design and install effluent sewer systems, and we only use equipment that is resistant to corrosion, lightweight, fully warrantied, and superbly engineered. If you decide that an effluent sewer is the right option for your community, you can pick from a pump collection system, often referred to as a STEP system, or a gravity collection system. Our effluent sewer system packages can also be complemented with our innovative monitoring system. This affordable, web-based remote telemetry system allows you to keep tabs on the overall function of your effluent sewer system to prevent extensive repairs and emergency situations. When our team designs and installs **effluent sewers**, we make sure that all permitting is properly handled. Right now, all of the collection and treatment systems we design and install are permitted through the Florida Department of Health and the Florida Department of Environmental Protection. If you have any questions about effluent sewers, how they operate, and why one of these systems might be a good fit for your community, please [reach out to us](/contact-southern-water-and-soil/) at Southern Water and Soil. We guarantee that we will help you make the right choice for your location’s wastewater collection and treatment needs and ensure that all phases of the installation process are completed according to your utmost satisfaction. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), [Miami](/package-plant-installations-miami-fl/effluent-sewers/), [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and **[Tampa](/package-plant-installations-tampa-fl/effluent-sewers/)**, [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Orlando, FL](https://southernsepticanddesign.com/package-plant-installations-orlando-fl/effluent-sewers/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## If your community in Orlando is looking for long-term, sustainable solutions, effluent sewers may be a great option. ![Effluent Sewers in Orlando, Florida](/wp-content/uploads/2016/10/88014103-septic-tank-design-resized-199x300.jpg)Not only are effluent sewers ideal for environmentally sensitive locations, but they can also be introduced into new subdivisions as an option for easy maintenance and long-term sustainability. At Southern Water and Soil, we are experienced in the design, installation, and maintenance of commercial septic systems, and we can assist your community in Orlando, Florida with the installation of an effluent sewer system. **Effluent sewers** are great for small to medium-sized communities that are part of a new subdivision or have specific environmental regulations that require an alternative to traditional wastewater treatment systems. Effluent sewers offer easy maintenance, are cost-effective, and give the option to reuse effluent produced through the system for irrigation purposes, depending upon your community’s needs. At Southern Water and Soil, we can also discuss whether our remote telemetry monitoring system would benefit your community, allowing you to check the function of your system and give advanced warning of emergency situations or necessary repairs. If your community is looking for long-term, sustainable solutions, **effluent sewers** may be a great option. More importantly, it is important that you work with an experienced company that can design, install, and educate about wastewater systems, so your community gets the best results. At Southern Water and Soil, our highly trained team always works to exceed customer expectations. [Contact us](/contact-southern-water-and-soil/) today to discuss your options. We look forward to working with you. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), [Miami](/package-plant-installations-miami-fl/effluent-sewers/), [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), **[Orlando](/package-plant-installations-orlando-fl/effluent-sewers/)**, Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Odessa, FL](https://southernsepticanddesign.com/package-plant-installations-odessa-fl/effluent-sewers/) **Published:** March 29, 2016 **Author:** Southern Water Soil **Content:** ## We are able to successfully design effluent sewers for communities in Odessa, FL and manage all aspects of the installation process. **![Effluent Sewers](/wp-content/uploads/2015/12/from-dropbox-Commercial-Septic-Tank-Installation-300x169.jpg)Effluent sewers** are becoming the best wastewater collection and treatment solution for small to mid-sized communities throughout the Odessa, Florida area. This is because these systems cost much less than conventional gravity sewers and because they are beneficial for environmentally sensitive areas. When these systems are properly designed, the effluent they produce can also be recycled and dedicated to irrigation purposes. At Southern Water and Soil, we are able to successfully design effluent sewers for communities and manage all aspects of the installation process. When we do so, the equipment we use is fully warrantied, superbly engineered, lightweight, and resistant to corrosion. If you make the decision that effluent collection and treatment is the right solution for your community, you can either go with a gravity collection system or a pump collection system. During the installation of effluent sewers, a large part of the process involves making sure that all proper permits are filled out and submitted. We manage all aspects of this process for you, and we do so through the Florida Department of Environmental Protection and the Florida Department of Health. Please [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today if you would like to find out more about **effluent sewers**, how they operate, and if one of these systems would be the right fit for your community. As dedicated septic design and installation professionals, we guarantee we will do whatever it takes to meet your specific wastewater system design and installation needs. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), [Miami](/package-plant-installations-miami-fl/effluent-sewers/), **[Odessa](/package-plant-installations-odessa-fl/effluent-sewers/)**, [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Miami, FL](https://southernsepticanddesign.com/package-plant-installations-miami-fl/effluent-sewers/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## If you are interested in effluent sewers, we are your number one resource for information and implementation in Miami. ![Effluent Sewers in Miami, Florida](/wp-content/uploads/2016/10/88014103-septic-tank-design-resized1-199x300.jpg)Is your community considering **effluent sewers** as an alternative to traditional septic systems? Do you want to make sure you have a cost-effective and sustainable option that will be easy to maintain as your community grows? At Southern Water and Soil, we are experienced in the design, installation, and maintenance of a variety of commercial septic systems. If you are interested in effluent sewers, we are your number one resource for information and implementation, so you achieve the best results. Effluent sewers offer a number of advantages for your community in Miami, FL: - Ideal for environmentally sensitive locations - Can be introduced into new subdivisions - Offer easy maintenance and long-term sustainability solutions - Great for small to medium-sized communities - Cost-effective options against traditional systems In addition, effluent sewers have the option to reuse effluent produced through the system for irrigation purposes. You may also be interested in a remote telemetry monitoring system that can warn against potential damage or problems and assist in the monitoring of your effluent sewers year-round. At Southern Water and Soil, we can discuss whether **effluent sewers** would benefit your community and assist with the design and installation from start to finish. These long-term, sustainable solutions can be a great option when you need long-lasting results. Furthermore, you need an experienced company to help your community achieve its goals – and at Southern Water and Soil, our highly-trained team is dedicated to exceeding your expectations. [Contact us](/contact-southern-water-and-soil/) today to discuss effluent sewers and your other wastewater treatment options. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), **[Miami](/package-plant-installations-miami-fl/effluent-sewers/)**, [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Lutz, FL](https://southernsepticanddesign.com/package-plant-installations-lutz-fl/effluent-sewers/) **Published:** February 22, 2016 **Author:** Southern Water Soil **Content:** ## When we design and install effluent sewers in Lutz, FL, we only use materials that are fully warrantied, superbly engineered, lightweight, and resistant to corrosion. ![Effluent Sewers](/wp-content/uploads/2016/02/88014103-septic-tank-design-199x300.jpg)Today, many communities throughout Lutz, Florida and the rest of the U.S. use an effluent sewer to collect and treat wastewater. Often, **effluent sewers** are an advantageous wastewater treatment solution for environmentally sensitive locations, mid-sized communities, and new subdivisions because they cost much less to operate than conventional gravity sewers. These systems can also produce effluent that can be repurposed for irrigation purposes if they are designed in the correct manner. At Southern Water and Soil, we design and install effluent sewers, and when we do so, we only use materials that are fully warrantied, superbly engineered, lightweight, and resistant to corrosion. We also offer different types of effluent sewers, including gravity collection systems, STEP systems, and pump collection systems. Additionally, our sewer system packages can be completed with an innovative monitoring system that allows you to keep an eye on the overall function of your effluent system using web-based remote telemetry technology. This ultimately allows you to prevent emergency situations and extensive repairs. When we design and install **effluent sewers**, we handle all of the permitting and ensure that it is properly completed. All of the treatment systems we design and install are permitted through the Florida Department of Environmental Protection and the Florida Department of Health. Please [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil if you have any questions about effluent sewers and to find out if one of these systems might be the right option for your community. With our extensive experience and knowledge, we guarantee that we will help you pick the right solution for your location’s wastewater collection and treatment needs. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), **[Lutz](/package-plant-installations-lutz-fl/effluent-sewers/)**, [Miami](/package-plant-installations-miami-fl/effluent-sewers/), [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Land O’ Lakes, FL](https://southernsepticanddesign.com/package-plant-installations-land-o-lakes-fl/effluent-sewers/) **Published:** June 7, 2016 **Author:** Southern Water Soil **Content:** ## If your community in Land O’ Lakes is looking for alternatives to traditional gravity sewer systems, we can assist you in installing effluent sewers that meet your needs. ![Effluent Sewers in Land O’ Lakes, Florida](/wp-content/uploads/2016/02/88014103-septic-tank-design-199x300.jpg)Is your community looking for a cost-effective solution to wastewater treatment, and you have been considering **effluent sewers** as a solution? Do you need a company that has experience with designing and installing effluent sewers? At Southern Water and Soil, we can assist your community with the professional installation of an effluent sewer system that provides the wastewater solutions you are looking for. - - **Small & Mid-Sized Communities** – Whether you are part of a new subdivision, in an environmentally sensitive location, or your community is looking for alternatives to traditional gravity sewer systems, we can assist you in utilizing effluent sewers that meet your needs. - **Easy Maintenance** – This cost-effective solution is easy to maintain for your community, and we can also offer an innovative monitoring system that allows remote telemetry, so your community can check on the function of your system and prevent potential emergency situations or unexpected repairs. - **Sustainable Practices –** Effluent sewers are not only cost-effective, but they also offer the option of reusing effluent produced through the system for irrigation purposes in your community. Especially if you are looking for long-term sustainable solutions, this design may be a great option. It is important that you work with a company that can properly design and install **effluent sewers**, so your community experiences all of the benefits of this system. At Southern Water and Soil, we have over 30 years of experience providing wastewater solutions for communities in Land O’ Lakes, Florida, and we can discuss your community’s options. Our highly trained team works to exceed customer expectations. [Contact us](/contact-southern-water-and-soil/) today to learn more. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), **[Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/)**, [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), [Miami](/package-plant-installations-miami-fl/effluent-sewers/), [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Fort Myers, FL](https://southernsepticanddesign.com/package-plant-installations-fort-myers-fl/effluent-sewers/) **Published:** July 11, 2016 **Author:** Southern Water Soil **Content:** ## The effluent sewers we design and install in Fort Myers are made out of equipment that is lightweight, corrosion-resistant, and impressively engineered. ![Effluent Sewers in Fort Myers, Florida](/wp-content/uploads/2016/07/2012-11-21-10.30-resized-300x169.jpg)Small and mid-sized communities throughout Fort Myers, Florida and the rest of the country are beginning to recognize the many benefits of **effluent sewers**. These systems are advantageous for many communities because they are much more cost-effective than traditional gravity sewers, and when properly designed, the effluent produced by these systems can be recycled and used for irrigation. Plus, these systems are extremely low maintenance. At Southern Water and Soil, the **effluent sewers** we design and install are made out of equipment that is lightweight, corrosion-resistant, and impressively engineered. We also offer two main types: gravity collection systems and pump collection systems. We will work diligently to determine which type is the best fit for your community, so you experience seamless, efficient operation for years to come. Additionally, our effluent sewer packages can be equipped with an innovative monitoring system. With this system, you can keep an eye on how your effluent sewer is functioning using affordable, web-based remote telemetry technology that is designed to help you prevent emergency situations and extensive repairs. To make things easier on you, we manage the permitting process when we install effluent services and ensure the installation process is handled with exactness. If you would like to know more about effluent sewers and if one of these systems could benefit your community, [reach out to us](/contact-southern-water-and-soil/) at Southern Water and Soil today. We look forward to hearing from you! --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), **[Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/)**, [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), [Miami](/package-plant-installations-miami-fl/effluent-sewers/), [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Florida](https://southernsepticanddesign.com/package-plant-installations-florida/effluent-sewers/) **Published:** April 18, 2024 **Author:** Southern Water Soil **Content:** ## We have the right experience to design, install, and maintain effluent sewer systems for your community. ![Effluent Sewers in Florida](/wp-content/uploads/2016/10/88014103-septic-tank-design-resized1-199x300.jpg)Our skilled team here at Southern Water and Soil has extensive experience in the wastewater management industry, and we understand that not all solutions work for all communities. Large cities, for example, often use extensive wastewater treatment facilities and gravity sewers, but these solutions may not be practical for small to mid-sized communities. For smaller communities, we typically recommend **effluent sewers** instead. Effluent sewers use pumps to move waste through the pipes rather than relying on gravity as traditional sewers do. These systems also trap the solids while sending liquid effluent further on for treatment. All our effluent sewers are designed to treat liquid effluent to the point where it can be used for irrigation, meaning you can use the graywater to keep your community’s landscapes lush and healthy. When you choose our team to install effluent sewers in your community, you can count on us to take care of every step of the process, from designing the system and acquiring the proper permits to installing the sewers and cleaning up after they have been successfully set up. We’ll make sure your new sewers deliver optimal performance, and we’ll always be just a call away whenever you need maintenance or repairs. If you have questions about our effluent sewers, we encourage you to reach out to us to get more information; we’ll be happy to help you determine if this option is the best fit for your area’s needs. Our team is proud to serve communities all over **Florida**, and we want to help you deal with your water and waste management needs. If you need better **effluent sewers** for your community, simply [give us a call](/contact-southern-water-and-soil/) to find out how we can help. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), [Miami](/package-plant-installations-miami-fl/effluent-sewers/), [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [**Florida**](/package-plant-installations-florida/effluent-sewers/).* --- ### [Effluent Sewers, Dade City, FL](https://southernsepticanddesign.com/package-plant-installations-dade-city-fl/effluent-sewers/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## Effluent sewers are often a good choice for the wastewater collection and treatment needs of small communities and new subdivisions in Dade City, FL. ![Effluent Sewers in Dade City, Florida](/wp-content/uploads/2016/02/88014103-septic-tank-design-199x300.jpg)Hundreds of communities throughout **Dade City, Florida** and America successfully collect and treat wastewater with an effluent sewer system. At Southern Water and Soil, we recognize that **effluent sewers** are becoming recognized as the best solution for small to mid-sized communities, environmentally sensitive locations, and new subdivisions in terms of wastewater collection and treatment because they cost much less than conventional gravity sewers. Additionally, when effluent sewers are properly designed, the effluent produced can be re-used for irrigation purposes, and they are extremely easy to maintain. We are proud of our ability to design and install effluent sewer systems, and we only use equipment that is resistant to corrosion, lightweight, fully warrantied, and superbly engineered. If you decide that an effluent sewer is the right option for your community, you can pick from a pump collection system, often referred to as a STEP system, or a gravity collection system. Our effluent sewer system packages can also be complemented with our innovative monitoring system. This affordable, web-based remote telemetry system allows you to keep tabs on the overall function of your effluent sewer system to prevent extensive repairs and emergency situations. When our team designs and installs **effluent sewers**, we make sure that all permitting is properly handled. Right now, all of the collection and treatment systems we design and install are permitted through the Florida Department of Health and the Florida Department of Environmental Protection. If you have any questions about effluent sewers, how they operate, and why one of these systems might be a good fit for your community, please [reach out to us](/contact-southern-water-and-soil/) at Southern Water and Soil. We guarantee that we will help you make the right choice for your location’s wastewater collection and treatment needs and ensure that all phases of the installation process are completed according to your utmost satisfaction. --- *At Southern Water and Soil, we offer services for **effluent sewers** in Brooksville, [**Dade City**](/package-plant-installations-dade-city-fl/effluent-sewers/), [Fort Myers](/package-plant-installations-fort-myers-fl/effluent-sewers/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/effluent-sewers/), [Lutz](/package-plant-installations-lutz-fl/effluent-sewers/), [Miami](/package-plant-installations-miami-fl/effluent-sewers/), [Odessa](/package-plant-installations-odessa-fl/effluent-sewers/), [Orlando](/package-plant-installations-orlando-fl/effluent-sewers/), Plant City, [Spring Hill](/package-plant-installations-spring-hill-fl/effluent-sewers/), and [Tampa](/package-plant-installations-tampa-fl/effluent-sewers/), [Florida](/package-plant-installations-florida/effluent-sewers/).* --- ### [Commercial Septic Tank Installation, Florida](https://southernsepticanddesign.com/commercial-septic-florida/commercial-septic-tank-installation/) **Published:** April 18, 2024 **Author:** Southern Water Soil **Content:** ## We have the skills and experience to tackle any commercial septic tank installation project. ![Commercial Septic Tank Installation in Florida](/wp-content/uploads/2017/03/2013-05-20-14.05.11-1-300x169.jpg)Properties within a city or municipality are typically connected to the city’s water system. These buildings can easily draw water from the city’s water lines when necessary, and they can seamlessly send wastewater to the city’s water treatment facilities. However, if your property is too far from the nearest municipality, you will need to use private septic tanks instead. Fortunately, our team here at Southern Water and Soil has extensive experience in dealing with septic issues, and you can count on us to help you find the most effective solutions for all your septic needs. We offer both residential and **commercial septic tank installation** services to help you keep your property safe and healthy for all. When you contact our team for help with a commercial septic tank installation project, we will first carefully assess your property’s needs. We’ll look at the size of your facility and how many people it is designed to serve to calculate the ideal size for your tank. Next, we’ll determine the best place to install the tank, drain field, and other essential components of the septic system. Once we have your approval, our team will get to work on the installation itself, excavating the land, installing the tank and pipes, and thoroughly restoring your landscape once the system has been successfully installed. We are proud to serve clients all over the state of **Florida**, and we would be honored to help you with your septic needs as well. If you need a septic tank for your business, don’t hesitate to [give us a call](/contact-southern-water-and-soil/) to get the expert **commercial septic tank installation** services you are looking for. --- *At Southern Water and Soil, we offer **commercial septic tank installation** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-tank-installations/), Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-tank-installation/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-tank-installation/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-tank-installation/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-tank-installations/), [**Florida**](/commercial-septic-florida/commercial-septic-tank-installation/).* --- ### [Commercial Septic Tank Installation, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-tank-installation/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Content:** ## We will make sure that your project meets commercial septic tank installation regulations in Tampa, FL. ![Commercial Septic Tank Installations](/wp-content/uploads/2014/07/2013-05-20-14.05.11-300x168.jpg)At Southern Water & Soil, we offer one-of-a-kind **commercial septic tank installations** for businesses of all sizes. Since we have engineers on staff, we are able to design septic systems that have unique components to fit with your needs and the style and feel of your property. We will come to your place of business to determine the possible environmental needs, as well as whether the space will do better with an alternative or a gravity-fed system. From there, we will generate a proposal that includes all of the aspects of the system that you want. If you prefer to have a less hands-on approach, we can also make recommendations based on our knowledge and expertise with commercial septic tank installations in the area. Our service area includes **Tampa, Florida**, and some of the nearby cities. We frequently work with local health departments, so we have good relationships with those connections. This makes it much easier for our team to obtain permits and understand the regulations around septic systems in the location of your property. Because of the potentially dangerous situation with human waste, there are heavy restrictions around **commercial septic tank installations**. We will make sure that everything in your project meets these regulations to ensure a safe and positive outcome. Our team includes staff members with a lot of knowledge about septic systems, including a registered sanitarian, previous environmental specialist, professional engineer, and more. Each of these experts will use his or her experience to make sure that your septic system is strong, durable, and always operates correctly. [Contact us](/contact-southern-water-and-soil/ "commercial septic systems experts") today for more details. --- *At Southern Water and Soil, we offer **commercial septic tank installation** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-tank-installations/), Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-tank-installation/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-tank-installation/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-tank-installation/), Orlando, Plant City, Wesley Chapel, Spring Hill, and **[Tampa](/commercial-septic-tampa-fl/commercial-septic-tank-installations/)**, [Florida](/commercial-septic-florida/commercial-septic-tank-installation/).* --- ### [Commercial Septic Tank Installation, Odessa, FL](https://southernsepticanddesign.com/commercial-septic-odessa-fl/commercial-septic-tank-installation/) **Published:** September 29, 2015 **Author:** Southern Water Soil **Content:** ## We are an ideal partner for commercial septic tank installation in Odessa, FL because we have over 30 years of experience. ![commercial septic tank installation](/wp-content/uploads/2015/09/2012-11-21-10.30-resized-300x169.jpg)Commercial septic tank installation is one of the more demanding tasks in setting up or replacing this key component of a commercial septic system. Because of the larger tank required for commercial properties due to the larger waste water generation, these tanks may be designed to handle thousands of gallons of waste and waste water at any given time. Customizing the size and other aspects of the tank and larger septic system will ensure that your property meets all local, state, and federal regulations regarding commercial septic systems. Before any system is decided on, it’s important to consider the waste water generation of the property and any specific needs that can be addressed before or during your **commercial septic tank installation**. The waste water flow is of principal importance, as the tank needs to be large enough to allow waste to settle out of the waste water flow. In addition, businesses such as laundromats will need to consider a lint trap as part of their septic system; likewise, any business that involves food will need to consider the use, placement, size, and maintenance of a grease trap to prevent these substances from entering the drain field. The placement of your commercial septic tank will be determined by the property itself, the layout of the drain pipe and drain field, and whether an above-ground or below-ground system works best for your area and business. At Southern Water and Soil, we are an ideal partner for **commercial septic tank installation** in the **Odessa, Florida** area because of our 30+ year commitment to providing all our customers with the most cost-effective and best designed systems for their particular waste water needs. [Give us a call](/contact-southern-water-and-soil/) today! --- *At Southern Water and Soil, we offer **commercial septic tank installation** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-tank-installations/), Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-tank-installation/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-tank-installation/), Miami, **[Odessa](/commercial-septic-odessa-fl/commercial-septic-tank-installation/)**, Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-tank-installations/), [Florida](/commercial-septic-florida/commercial-septic-tank-installation/).* --- ### [Commercial Septic Tank Installation, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-tank-installation/) **Published:** January 21, 2016 **Author:** Southern Water Soil **Content:** ## Our expertly trained staff will see your commercial septic tank installation through from start to finish in Lutz, FL. ![Commercial Septic Tank Installation, Lutz, FL](/wp-content/uploads/2016/01/2012-01-26-13.34.57-300x179.jpg)Unless your **Lutz, Florida** business is located near a waste processing plant, you probably have a septic system on your property. Septic systems are designed to process the wastewater that comes from toilets, laundry facilities, and sinks before releasing it back into the environment. Commercial septic systems are designed to handle high volumes of waste from large buildings like office buildings and apartment complexes. In order to make sure that your commercial septic system is right for your property, you should hire a professional to create the design and perform the commercial septic tank installation. Septic tanks come in a wide variety of sizes, and choosing the right one is very important. It is also essential that you choose the right location for your **commercial septic tank installation**, to ensure that water flows properly into and out of the tank. If you find yourself in need of septic system design or **commercial septic tank installation**, be sure to make Southern Water and Soil your first call. We are experts in the septic industry, so you can count on us to get the job done quickly and efficiently. Plus, our prices are highly affordable. At Southern Water and Soil, we pride ourselves on providing top-notch customer service. From the moment you call for a free quote to the moment we complete your commercial septic tank installation, you can rest assured knowing that we will do whatever it takes to make you happy. We have many years of experience in the industry and a staff of expertly trained professionals who will see your project through from start to finish. What are you waiting for? [Call us today!](/contact-southern-water-and-soil/) --- *At Southern Water and Soil, we offer **commercial septic tank installation** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-tank-installations/), Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-tank-installation/), **[Lutz](/commercial-septic-lutz-fl/commercial-septic-tank-installation/)**, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-tank-installation/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-tank-installations/), [Florida](/commercial-septic-florida/commercial-septic-tank-installation/).* --- ### [Commercial Septic Tank Installation, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-tank-installation/) **Published:** June 7, 2016 **Author:** Southern Water Soil **Content:** ## We offer commercial septic tank installation for new construction or replacement in Land O’ Lakes. ![Commercial Septic Tank Installation in Land O’ Lakes, Florida](/wp-content/uploads/2015/07/2013-05-20-14.05.11-300x168.jpg)At Southern Water and Soil, we are a full-service septic company that provides quality **commercial septic tank installation** services in **Land O’ Lakes, Florida**. With our 30 years of combined experience, we can easily design, engineer and install any system your business may need. We also offer commercial septic tank installation for new construction or replacement if you are having issues with one or more parts of your septic system. When you choose us as your commercial septic company, you will find that our technicians are highly qualified and work to exceed customer expectations. You will feel comfortable knowing we are prepared to address any issues that arise and ensure your system is working properly when commercial septic installation is complete. Something that sets our septic company apart from our competitors is that we are dedicated to finding point-of-origin solutions to water quality and quantity challenges in Land O’ Lakes. Whether you are a small municipality, a new business development, or a residential area, we can provide wastewater management solutions to meet your needs. We offer excellent customer service to every client we serve, we will keep you informed about each step of the installation, and we will make sure you are happy for the duration of your project. If you have a question about what our team at Southern Water and Soil can do assist you with **commercial septic tank installation**, [contact us](/contact-southern-water-and-soil/) today to learn more. We are prepared to answer your questions, assist in finding wastewater management solutions, and complete commercial septic tank installation designed specifically for your needs. --- *At Southern Water and Soil, we offer **commercial septic tank installation** services in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-tank-installations/), Fort Myers, **[Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-tank-installation/)**, [Lutz](/commercial-septic-lutz-fl/commercial-septic-tank-installation/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-tank-installation/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-tank-installations/), [Florida](/commercial-septic-florida/commercial-septic-tank-installation/).* --- ### [Commercial Septic Tank Installation, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-tank-installation/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## We will make sure that your project meets commercial septic tank installation regulations in Dade City, FL. ![Commercial Septic Tank Installations in Dade City, Florida](/wp-content/uploads/2014/07/2013-05-20-14.05.11-300x168.jpg)At Southern Water & Soil, we offer one-of-a-kind **commercial septic tank installations** for businesses of all sizes. Since we have engineers on staff, we are able to design septic systems that have unique components to fit with your needs and the style and feel of your property. We will come to your place of business to determine the possible environmental needs, as well as whether the space will do better with an alternative or a gravity-fed system. From there, we will generate a proposal that includes all of the aspects of the system that you want. If you prefer to have a less hands-on approach, we can also make recommendations based on our knowledge and expertise with commercial septic tank installations in the area. Our service area includes **Dade City, Florida**, and some of the nearby cities. We frequently work with local health departments, so we have good relationships with those connections. This makes it much easier for our team to obtain permits and understand the regulations around septic systems in the location of your property. Because of the potentially dangerous situation with human waste, there are heavy restrictions around **commercial septic tank installations**. We will make sure that everything in your project meets these regulations to ensure a safe and positive outcome. Our team includes staff members with a lot of knowledge about septic systems, including a registered sanitarian, previous environmental specialist, professional engineer, and more. Each of these experts will use his or her experience to make sure that your septic system is strong, durable, and always operates correctly. [Contact us](/contact-southern-water-and-soil/ "commercial septic systems experts") today for more details. --- *At Southern Water and Soil, we offer **commercial septic tank installation** services in Brooksville, [**Dade City**](/commercial-septic-dade-city-fl/commercial-septic-tank-installations/), Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-tank-installation/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-tank-installation/), Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-tank-installation/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-tank-installations/), [Florida](/commercial-septic-florida/commercial-septic-tank-installation/).* --- ### [Master Septic Contractor, Tampa, FL](https://southernsepticanddesign.com/master-septic-contractor-tampa-fl/) **Published:** March 30, 2022 **Author:** Southern Water Soil **Content:** ## Our owner is a master septic contractor. At Southern Water and Soil, our owner, Greg Mayfield, R.S., M.S.C., C.E.H.P., is a **master septic contractor**. In the **Tampa, Florida** area, you must obtain proper permits and inspections from the local municipality and submit a detailed site plan, before you can install a new septic system at a building site or replace an existing system. Securing the involvement of a master septic contractor with this part of the process can expedite the inspection and allow the construction process to continue without delay. ![Master Septic Contractor in Tampa, Florida](/wp-content/uploads/2022/03/2012-01-26-13.34.57_res.jpg) Every **master septic contractor** in our area plays an important role in the development of new septic projects, and you can find Greg Mayfield and other master septic contractors [listed here](https://www.floridahealth.gov/statistics-and-data/eh-tracking-and-reporting/septic-tank-contractors.html) on the state’s website. What does it take to become a master septic contractor? To be eligible for registration in the state of Florida, you must meet the following qualifications: - Have three years of experience as a septic tank contractor in the state of Florida. This three-year period must not be interrupted by a revocation, suspension, or probation of any licensing agency. - Take and complete at least 30 hours of coursework approved by the Florida Department of Health. - Pass an exam that shows you have advanced knowledge of the installation and maintenance of septic systems. This exam covers topics like performing soil evaluations, designing systems, and closing residential repair jobs. - Undergo a review for any major infractions or other laws relating to onsite sewage treatment and disposal. Because our owner is a master septic contractor, we can successfully complete any septic project you present to us, no matter its scope or level of intricacy. For more information, please [contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, our **master septic contractors** proudly serve [Brooksville](/master-septic-contractor-brooksville-fl/), [Dade City](/master-septic-contractor-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/master-septic-contractor-odessa-fl/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [**Tampa**](/master-septic-contractor-tampa-fl/), [Florida](/master-septic-contractor-florida/).* --- ### [Master Septic Contractor, Odessa, FL](https://southernsepticanddesign.com/master-septic-contractor-odessa-fl/) **Published:** September 28, 2023 **Author:** Southern Water Soil **Content:** ## Rely on our master septic contractor to ensure that your project is completed with minimal headaches and maximum cost effectiveness. At Southern Water and Soil, our owner is a **master septic contractor**. What does this mean? In the state of Florida, it means that he has more than three years of experience as a septic tank contractor in the state (we actually have three decades of experience!). It also requires 30+ hours of coursework dictated by the Florida Department of Health. There is an exam that must be passed to demonstrate advanced knowledge of septic systems, their installation, and their maintenance. Finally, a review of onsite sewage treatment and disposal practices must be completed, showing no major infractions or violations of the regulations and law. ![Master Septic Contractor in Odessa, Florida](/wp-content/uploads/2022/03/2012-01-26-13.34.57_res.jpg) So, what does this mean for you and your septic needs? It means that you can rely on our master septic contractor to ensure that your project is completed with minimal headaches and maximum cost effectiveness. Any time that a septic installation or replacement is needed, detailed site plans are required. You must have the proper permits on file and have appropriate inspections completed. All of this can be expedited by the presence of a master septic contractor, who can reduce construction delays. We are available to work as your **master septic contractor** no matter what type of property you have. We perform residential, commercial, and other septic work of all kinds, including installations, repairs and maintenance, upgrades, and full replacements. If you find yourself in need of a septic contractor in **Odessa, Florida** or the surrounding area, don’t hesitate to [reach out to us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, our **master septic contractors** proudly serve [Brooksville](/master-septic-contractor-brooksville-fl/), [Dade City](/master-septic-contractor-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [**Odessa**](/master-septic-contractor-odessa-fl/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/master-septic-contractor-tampa-fl/), [Florida](/master-septic-contractor-florida/).* --- ### [Master Septic Contractor, Brooksville, FL](https://southernsepticanddesign.com/master-septic-contractor-brooksville-fl/) **Published:** November 27, 2023 **Author:** Southern Water Soil **Content:** ## Hire a master septic contractor for your project. Working with a **master septic contractor** is one of the best ways to ensure your septic project moves forward without delay. Our owner and founder is a master septic contractor and will use his expertise when involved with your septic system project. ![Master Septic Contractor in Brooksville, Florida](/wp-content/uploads/2022/03/2012-01-26-13.34.57_res.jpg) One of the main reasons to work with a master septic contractor is to expedite the acquirement of proper permits during a septic project. When working with a master septic contractor, you can rely on them to submit a detailed site plan with the local municipality and ensure that you are able to get the permits you need without delay. To become a master septic contractor, there are several requirements you must meet. For example, you must have at least three years of experience working as a septic tank contractor in the state of Florida. You must also participate in and complete at least 30 hours of coursework that is approved by the Florida Department of Health. Once you finish this coursework, you must pass an exam that illustrates your advanced knowledge of septic systems. When you hire a master septic contractor to work on your project in **Brooksville, Florida**, you can rest easy knowing that you are hiring someone who has extensive knowledge of septic systems. At Southern Water and Soil, we are proud of our owner’s status as a **master septic contractor**, as well as our ample experience working with septic systems. For more information about the work we do, [contact us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, our **master septic contractors** proudly serve [**Brooksville**](/master-septic-contractor-brooksville-fl/), [Dade City](/master-septic-contractor-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/master-septic-contractor-odessa-fl/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/master-septic-contractor-tampa-fl/), [Florida](/master-septic-contractor-florida/).* --- ### [Master Septic Contractor, Dade City, FL](https://southernsepticanddesign.com/master-septic-contractor-dade-city-fl/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## Our owner is a master septic contractor. At Southern Water and Soil, our owner, Greg Mayfield, R.S., M.S.C., C.E.H.P., is a **master septic contractor**. In the **Dade City, Florida** area, you must obtain proper permits and inspections from the local municipality and submit a detailed site plan, before you can install a new septic system at a building site or replace an existing system. Securing the involvement of a master septic contractor with this part of the process can expedite the inspection and allow the construction process to continue without delay. ![Master Septic Contractor in Dade City, Florida](/wp-content/uploads/2022/03/2012-01-26-13.34.57_res.jpg) Every **master septic contractor** in our area plays an important role in the development of new septic projects, and you can find Greg Mayfield and other master septic contractors [listed here](https://www.floridahealth.gov/statistics-and-data/eh-tracking-and-reporting/septic-tank-contractors.html) on the state’s website. What does it take to become a master septic contractor? To be eligible for registration in the state of Florida, you must meet the following qualifications: - Have three years of experience as a septic tank contractor in the state of Florida. This three-year period must not be interrupted by a revocation, suspension, or probation of any licensing agency. - Take and complete at least 30 hours of coursework approved by the Florida Department of Health. - Pass an exam that shows you have advanced knowledge of the installation and maintenance of septic systems. This exam covers topics like performing soil evaluations, designing systems, and closing residential repair jobs. - Undergo a review for any major infractions or other laws relating to onsite sewage treatment and disposal. Because our owner is a master septic contractor, we can successfully complete any septic project you present to us, no matter its scope or level of intricacy. For more information, please [contact us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, our **master septic contractors** proudly serve [Brooksville](/master-septic-contractor-brooksville-fl/), [**Dade City**](/master-septic-contractor-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/master-septic-contractor-odessa-fl/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/master-septic-contractor-tampa-fl/), [Florida](/master-septic-contractor-florida/).* ### Similar Services We Offer: --- ### [Master Septic Contractor, Florida](https://southernsepticanddesign.com/master-septic-contractor-florida/) **Published:** March 20, 2024 **Author:** Southern Water Soil **Content:** ## Our designs focus on efficiency, sustainability, and compliance. As a home or business owner in **Florida**, finding a qualified master septic contractor you can depend on makes all the difference in keeping your wastewater system running smoothly for years. We have proudly carried the exclusive designation of **master septic contractor** for over 30 years. This title highlights our team’s best-in-class expertise in septic system engineering, installations, inspections, and repairs. ![Master Septic Contractor in Florida](/wp-content/uploads/2022/03/2012-01-26-13.34.57_res.jpg) As a **master septic contractor**, we engineer and construct new septic systems tailored specifically for your property’s soil, landscape, drainage, and occupancy needs with exacting standards. As your master septic contractor at Southern Water and Soil, we have in-depth knowledge of licensing, which takes the headaches out of permitting and inspections. We’ll handle all the paperwork and coordinate people to keep your projects on budget and on time. We stay ahead of the curve by continually researching and integrating the latest technology, such as advanced treatment systems. We leverage our 30 years of work into a deep understanding of wastewater management and can create customized wastewater treatment systems that meet your community’s or development’s specific needs. Our designs focus on efficiency, sustainability, and compliance with all regulatory standards. Precision in installation is key to the success of any septic system. Our skilled technicians ensure that every system component is installed with meticulous attention to detail, guaranteeing optimal operation from day one. We also understand that even the best-designed septic systems can experience occasional issues, so we provide maintenance services to help fend off potential malfunctions. When septic system expertise and quality matters most, rely on a master septic contractor. [Contact us](/contact-southern-water-and-soil/) to discuss your septic system needs. --- *At Southern Water and Soil, our **master septic contractors** proudly serve [Brooksville](/master-septic-contractor-brooksville-fl/), [Dade City](/master-septic-contractor-dade-city-fl/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/master-septic-contractor-odessa-fl/), Orlando, Plant City, Wesley Chapel, Spring Hill, and [Tampa](/master-septic-contractor-tampa-fl/), **[Florida](/master-septic-contractor-florida/)**.* --- ### [Drain Field Options, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-options/) **Published:** January 15, 2024 **Author:** Southern Water Soil **Content:** ## We offer drain field options to our clients, helping to design systems that align with property needs. There are many properties located in and around **Spring Hill, Florida** that rely on septic systems to process and store liquid and solid waste. Since many of the properties found in this area are spread apart from one another, they aren’t always connected to the city sewage treatment plant. But what people may not realize is that they’re not required to have the same septic system as their neighbor down the road. There are plenty of options available, and you can get components that work better on your unique property and ensure a smooth flow through the plumbing system. ![Drain Field Options in Spring Hill, Florida](/wp-content/uploads/2017/04/drainfiedloptions.jpg) Drain fields play an essential role in septic systems, allowing the treated effluent to re-enter the surrounding soil. There are a number of different **drain field options**, including aerobic or anaerobic treatment systems, chamber systems, mound and drip distribution systems, and others. The right type of drain field for your property will depend on various factors, including its grade, soil conditions, and overall layout. At Southern Water and Soil, we offer drain field options to our clients, helping to design systems that align with specific property needs. Our highly trained team of industry experts can assess your property, whether you have a system in place or not, and provide information about **drain field options** and which would work best. We can also answer questions and provide insights about caring for your new system in the future. With years of experience and countless successful projects under our belt, we’re the team to count on for all your septic needs. [Contact us](/contact-southern-water-and-soil/) to learn more. --- *At Southern Water and Soil, we offer a variety of **drain field options** in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-options/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-options/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-options/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-options/), Orlando, Plant City, Wesley Chapel, [**Spring Hill**](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-options/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-options/), Florida.* --- ### [Drain Field Options, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-drain-field/drain-field-options/) **Published:** November 2, 2015 **Author:** Southern Water Soil **Content:** ## A number of factors determine your different drain field options in Tampa, FL. ![Drain Field Options](/wp-content/uploads/2015/11/2013-07-29-14.17.02-300x169.jpg)The sizing for commercial **drain field options** in Tampa, FL can be very hard to predict and varies greatly, depending on the type of industry the building serves. Size recommendations depend on the number of occupants and their average daily wastewater consumption. Factories may have employees who use both the toilet as well as an after-work shower, while gas stations and fast food spots may see hundreds to even thousands of people using the restroom every day. Septic drain field options in regards to size are based on three main factors: 1. The soil percolation rate in minutes per inch 2. The number of building occupants 3. The number of linear feet needed to handle the wastewater daily flow While these typically give a firm example of **drain field options** in Tampa, FL for residential properties, further evaluation is needed for commercial locations. The three main categories for business septic system needs are commercial (bars, hotels, shopping centers), institutional (schools, hospitals) and recreational (theaters, gyms). These categories help to estimate the typical usage that the drain field will encounter on a daily, weekly, and monthly basis. All of this information is used to find adequate drain field options in Tampa, FL. Size is arguably the most important factor in selecting your drain field, as most buildings use the conventional type of gravel filtering with soil on top. Of course, here at Southern Water and Soil, we do cater to your options and also feature gravelless and chamber systems. Please [contact us](/contact-southern-water-and-soil/) for more information on commercial drain field options for your specific industry. --- *At Southern Water and Soil, we offer a variety of **drain field options** in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-options/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-options/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-options/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-options/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-options/), and **[Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-options/)**, Florida.* --- ### [Drain Field Options, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-drain-field/drain-field-options/) **Published:** March 22, 2016 **Author:** Southern Water Soil **Content:** ## Carefully review your drain field options in Lutz, FL, and then call us to do the installation. ![Drain Field Options](/wp-content/uploads/2015/09/Drain-Field-Options-300x225.jpg)When it comes to installing a septic system on your Lutz, FL property, there are a variety of factors to consider. For one thing, the size of your home or business will determine the size of your septic tank. If you have a one-bathroom home, you may only need a small septic tank, but if you have a large office building or apartment complex, you may need a large septic tank. In addition to thinking about the size of your septic tank, you also need to consider your drain field options. When it comes to designing a drain field, you have three main factors to consider: - The number of people occupying the property - The number of linear feet needed to handle wastewater - The rate of soil percolation in minutes per inch To the average home or business owner, these three factors may not mean much, but to an experienced septic company like Southern Water and Soil, they mean everything. When you hire us to design and install your septic system, we will carefully consider the drain field options listed above to make sure that the system we build is perfectly suited to your needs. Designing a custom septic system is no easy task, so you want to make sure that you hire an experienced company to do the work. At Southern Water and Soil, we have many years of experience and are experts in the septic industry. You can count on us to design your Lutz, FL septic system with precision and care to ensure top-notch results. Call us today to receive a free quote or simply to request more information about our septic services and drain field options. --- *At Southern Water and Soil, we offer a variety of **drain field options** in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-options/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-options/), **[Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-options/)**, Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-options/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-options/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-options/), Florida.* --- ### [Drain Field Options, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-drain-field/drain-field-options/) **Published:** May 12, 2016 **Author:** Southern Water Soil **Content:** ## Drain field options need to consider the anticipated usage and can vary widely from one property to another. ![Drain Field Options in Land O’ Lakes, Florida](/wp-content/uploads/2016/05/Drain-Field-Options-300x225.jpg) It is a common misconception that the drain field is the same for all types of businesses. In fact, many people assume that all components of a septic system don’t vary much from one to another. The reality is that there are several septic tank and **drain field options** to be considered when installing a septic system at a Land O’ Lakes, Florida commercial property. At Southern Water and Soil, we never just take over and do what we want. We prefer to discuss why we recommend a particular system that has been determined based on factors specific to you, so you understand the various **drain field options**. This gives you ample opportunity to request something above the minimums set by code regulations, which isn’t a bad idea if you plan to expand the business at a later date, extend business hours significantly, or undertake endeavors that will result in more waste. Some of the factors that go into determining drain field options include the number of building occupants, soil percolation rate in minutes per inch, and the number of linear feet needed to handle daily wastewater flow. We will go over anything that can affect capacity so that the best drain field options are considered. If you have any questions about how we determine which drain field options to incorporate in a new installation or replacement system, don’t hesitate to [contact us](/contact-southern-water-and-soil/) for more information. We are happy to explain how systems work and how to choose the right septic system options for your situation. --- *At Southern Water and Soil, we offer a variety of **drain field options** in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-options/), Fort Myers, **[Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-options/)**, [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-options/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-options/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-options/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-options/), Florida.* --- ### [Drain Field Options, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-options/) **Published:** April 18, 2017 **Author:** Southern Water Soil **Content:** ## We offer the drain field options you need to truly get the best results from your septic system in Dade City. ![Drain Field Options in Dade City, FL](/wp-content/uploads/2017/04/drainfiedloptions.jpg) At Southern Water and Soil, we believe that having the right drain field for your commercial or residential septic system is an essential part of a well-functioning system. When you work with our experienced team at your property in Dade City, Florida, you will find that we offer the **drain field options** you need to truly get the best results over the life of your septic system and drain field. - Design & Installation – From the initial design and installation, our highly cross-trained team can make expert recommendations for the drain field options that will work best for your space. Whether you are interested in a decentralized septic system or you need unique solutions due to space requirements, we can provide the options and alternatives that will work best. - Replacement – When you require drain field replacement, you want to work with an experienced team that knows how to help you achieve your goals. Our team has over 30 years of combined experience, and we’ll provide the drain field options you need to get the most from the replacement of your septic drain field. - Repair – Sometimes a drain field repair requires unique **drain field options** due to space limitations, the age of your septic system, and other factors. At Southern Water and Soil, we’ll always work to make sure your drain field repairs provide the long-lasting solutions you need for your home or business If you need drain field services in Dade City, Florida, [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today for more information. --- *At Southern Water and Soil, we offer a variety of **drain field options** in Brooksville, **[Dade City](/commercial-septic-drain-field-brandon/drain-field-options/)**, Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-options/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-options/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-options/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-options/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-options/), Florida.* --- ### [Drain Field Installation, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-installation/) **Published:** January 15, 2024 **Author:** Southern Water Soil **Content:** ## When it’s time for a new drain field on your property, we’re the ones to call. Part of the installation process of a septic system involves designing and laying out the various components, such as the tank and drain field. The tank is where liquid and solid waste go after moving through the plumbing within the connected home or business. Heavier waste moves to the bottom of the septic tank, while liquid waste rises to the top and undergoes treatment. This liquid, called effluent, can then leave the tank through another set of pipes, where it goes into the drain field for reabsorption into the surrounding soil. ![Drain Field Installation in Spring Hill, Florida](/wp-content/uploads/2017/03/drainfield.jpg) A drain field typically consists of perforated pipes buried under the ground and often with a layer of gravel to provide additional filtration. While the parts that make up this component of the septic system may seem uncomplicated, its purpose is far from simple, which is why it’s so essential to leave all **drain field installation** and other services in the hands of a skilled professional. Here in **Spring Hill, Florida**, property owners can work with us at Southern Water and Soil for a range of septic services, including professional drain field installation. Whether we’re replacing an existing drain field that is no longer functioning properly or performing **drain field installation** as part of the construction of a new system, we’ll take the time to do it right. We assess the entire property to determine where to place each component, ensuring that the drain field will be properly protected from damage. When you’re looking for the best in septic work, turn to our highly trained and experienced technicians. [Contact us](/contact-southern-water-and-soil/) today to get started with a quote for service! --- *At Southern Water and Soil, we offer **drain field installation** services in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-installation/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-installation/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-installation/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-installation/), Orlando, Plant City, Wesley Chapel, [**Spring Hill**](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-installation/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-installation/), Florida.* --- ### [Drain Field Installation, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-drain-field/drain-field-installation/) **Published:** November 2, 2015 **Author:** Southern Water Soil **Content:** ## Whether in a new build or renovation in Tampa, FL, the inclusion of a drain field installation is mandatory for properties with septic systems. ![drain field installation](/wp-content/uploads/2015/11/2013-11-05-02.16.44-300x300.jpg)When deciding whether to perform a drain field installation on a property in Tampa, FL with a septic tank, the government has already made the decision for you – it’s a requirement. Every time customers and employees use the toilet, run the faucet, or do a load of laundry, a portion of the water and waste go into the septic tank, while a lot of the water seeps into the drain field – a necessary operation. Commercial **drain field installation** is an important cog in the septic system to help remove the contaminants from the liquid in a septic system. The ‘septic system’ in fact consists of the septic tank, the drain field, and all the piping associated with the travel from the home. We specialize in new drain field installation for your Tampa, FL commercial property. Typically a drain field consists of trenches with perforated pipes and a material (usually gravel) that is used to filter the water. The gravel is topped with soil to prevent animals or other exposure, and the system functions largely sight unseen. Whether you are looking for a **drain field installation** for new building construction in Tampa, FL or a replacement for a system that has gone wrong, we are your experts in the field. At Southern Water and Soil, we not only lay out the drain field in the most convenient location to not affect surrounding businesses, but we also perform the percolation tests, permit applications, and other requirements to ensure the system conforms to all local Tampa, FL commercial regulations. We are your one-stop partner in the field for all things related to commercial drain field and septic installation. --- *At Southern Water and Soil, we offer **drain field installation** services in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-installation/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-installation/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-installation/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-installation/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-installation/), and **[Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-installation/)**, Florida.* --- ### [Drain Field Installation, Lutz, FL](https://southernsepticanddesign.com/commercial-septic-lutz-fl/commercial-septic-drain-field/drain-field-installation/) **Published:** March 22, 2016 **Author:** Southern Water Soil **Content:** ## We work hard to make sure your drain field installation goes smoothly in Lutz, FL. ![Drain Field Installation, Lutz, FL](/wp-content/uploads/2015/06/Septic-System-Upgrade1-300x169.jpg)Many Lutz, FL home and business owners do not know the first thing about their septic system. In fact, they may not even think about it unless something goes wrong. Your septic system is an essential part of your property, however, because it is responsible for processing waste. If your septic system is too small, or if it is damaged, you could end up with sewage backed up into your building or on your property. To make sure these things don’t happen, you need to be very careful about who you hire for your septic system design and drain field installation. A septic system generally consists of a septic tank and a drain field. The tank is where the wastewater is processed for the first time and the water is separated from the waste. The water then flows through the drain field for further filtration before seeping back into the environment. Proper drain field installation is integral to the overall function of your septic system, so make sure you hire a professional to do the job. Our professional septic service will be able to assess your needs to build and install the right drain field for your property. We will also provide supportive services after the installation is complete. It doesn’t matter how well your drain field is designed if it isn’t correctly installed. That is why you should trust our team at Southern Water and Soil for your drain field installation job in Lutz, FL. We not only have many years of experience in the industry, but also make customer satisfaction our top priority. If you aren’t satisfied at any point in the project, we will do whatever it takes to make things right. --- *At Southern Water and Soil, we offer **drain field installation** services in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-installation/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-installation/), **[Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-installation/)**, Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-installation/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-installation/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-installation/), Florida.* --- ### [Drain Field Installation, Land O’ Lakes, FL](https://southernsepticanddesign.com/commercial-septic-land-o-lakes-fl/commercial-septic-drain-field/drain-field-installation/) **Published:** May 12, 2016 **Author:** Southern Water Soil **Content:** ## For a drain field to work properly, the drain field installation must be done with care and attention to detail. ![Drain Field Installation in Land O’ Lakes, Florida](/wp-content/uploads/2016/05/Drain-Field-Installation-300x169.jpg) Unless you are on the municipal sewer system, your Land O’ Lakes, Florida business is required to have a septic tank and **drain field installation** that meets code requirements for safe and effective wastewater treatment. Even if it weren’t a requirement, you wouldn’t want the soil and groundwater of your property to be contaminated. At Southern Water and Soil, we will perform your drain field installation to meet or exceed code regulations, keeping in mind your current and future needs so the right size and type of system is installed. Whether you need **drain field installation** for new construction, to upgrade a system to accommodate the building of a larger facility or expansion of a building, or to replace a worn-out or damaged drain field, you can count on our dedication to excellence to provide the best possible results. Our highly cross-trained team puts your needs first, so your drain field installation project goes smoothly and matches the initial design. When you call on us to discuss drain field installation, we take the time to assess your situation and answer all questions you may have. Our goal is to make you a well-informed customer, so we are confident you know what to expect from day one to the completion of your project. By providing you with ample education about how these systems work, we ensure you know how to properly care for your drain field and can avoid drain field installation again in the near future because of a preventable situation. [Contact us today](/contact-southern-water-and-soil/) to schedule a consultation to discuss your project. --- *At Southern Water and Soil, we offer **drain field installation** services in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-installation/), Fort Myers, **[Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-installation/)**, [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-installation/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-installation/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-installation/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-installation/), Florida.* --- ### [Drain Field Installation, Dade City, FL](https://southernsepticanddesign.com/commercial-septic-dade-city-fl/commercial-septic-drain-field/drain-field-installation/) **Published:** March 29, 2017 **Author:** Southern Water Soil **Content:** ## We are equipped to ensure that you get the most from your new drain field installation in Dade City. ![Drain Field Installation](/wp-content/uploads/2017/03/drainfield.jpg)When you require commercial or residential drain field installation, you should only go to the top company for the job. At Southern Water and Soil, we have decades of experience providing high-quality septic services for our customers in Dade City, Florida, and we are equipped to ensure that you get the most from your new drain field installation. Whether your current drain field is not functioning like it should or you are building a new commercial facility, our team at Southern Water and Soil will work to provide the solutions you require. Our **drain field installation** services aren’t just about laying pipes in the ground– we’ll complete a full assessment of your property, ensure that your drain field design is ideal for your needs, and provide the drain field installation services that give you the most from your septic system over the long-term. Having a drain field installed on your property is a requirement if you utilize either a residential or commercial septic system, and you can rely on us for the comprehensive services you need to get the best results. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil if you are experiencing a septic system issue, or if you require new **drain field installation** at your property in Dade City. We are experts in the area of drain field design and installation, as well as a variety of other septic maintenance and servicing items. You can rely on us at Southern Water and Soil for all your septic needs. Call us today to get started! --- *At Southern Water and Soil, we offer **drain field installation** services in Brooksville, **[Dade City](/commercial-septic-drain-field-brandon/drain-field-installation/)**, Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-installation/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-installation/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-installation/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-installation/), and [Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-installation/), Florida.* --- ### [Drain Field Design, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-drain-field/drain-field-design/) **Published:** November 2, 2015 **Author:** Southern Water Soil **Content:** ## Drain field design is arguably the most important aspect of septic performance in Tampa, FL. ![Drain Field Design](/wp-content/uploads/2015/11/2011-08-04-11.36.53-300x179.jpg)One of the risks that any business faces with their septic system is a failure that was simply unpreventable. Over the years, roots can impede the flow of liquid and waste from the building to the septic tank, and other times, system components simply fail. Of course there are other times when septic systems in Tampa, FL fail because of improper drain field design – but this is an issue that is 100% preventable. The importance of **drain field design** in Tampa, FL should never be underestimated. In fact, it could be argued that first having an optimum and efficient design is just as important as the proper installation of the components. For example, drain field design considerations include: - **Size** – Especially in the commercial industry, a septic tank and subsequent **drain field design** should be apt to handle the amount of water flow produced on the property. - **Location** – One of the issues facing a commercial septic system installation is finding the best location for the components and drain field. Heavy equipment and constant traffic can damage the components of the septic system, so high-traffic areas should be avoided. - **Soil** – Drain field design should take into account if the soil is suitable for filtering the water produced. Compromising of any of these details (among others) with drain field design could lead to a septic system failure. In a commercial setting, if the septic system fails, it means the business must close; therefore, it’s important to work with an industry leader from our team at Southern Water and Soil to prevent these issues from occurring. We are experienced in not only the installation of septic components, but the engineering side, as well. --- *At Southern Water and Soil, we offer **drain field design** services in Brooksville, [Dade City](/commercial-septic-drain-field-brandon/drain-field-design/), Fort Myers, [Land O’ Lakes](/commercial-septic-drain-field-land-o-lakes-fl/drain-field-design/), [Lutz](/commercial-septic-drain-field-lutz-fl/drain-field-design/), Miami, [Odessa](/commercial-septic-drain-field-odessa-fl/drain-field-design/), Orlando, Plant City, Wesley Chapel, [Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-drain-field/drain-field-design/), and **[Tampa](/commercial-septic-drain-field-tampa-fl/drain-field-design/)**, Florida.* --- ### [Drip Irrigation Systems, Odessa, FL](https://southernsepticanddesign.com/septic-services-odessa-fl/drip-irrigation-systems/) **Published:** September 29, 2015 **Author:** Southern Water Soil **Content:** ## Drip irrigation systems in Odessa, FL reduce your septic drain field mound. ![Drip Irrigation Systems](/wp-content/uploads/2015/09/2011-03-17-17.28-resized-300x179.jpg)Drip irrigation systems are a simple, effective, and amazingly efficient way to provide water to the plants and other landscaping. Many different types of these systems exist, and it’s important to understand two principles of good drip irrigation system design and execution. First, know your property. This includes the major trees, shrubs, and plants the **drip irrigation systems** will support, as well as other plants that are benefited by the drip system. The type of soil is also very important, as it will determine what type of emitters makes the most sense in your system. If your terrain has a significant slope, this may require different types of emitters. The type of plant the system is supporting will also determine the spacing between emitters. Because of the large amount of work done on researching drip irrigation systems abroad, especially in Israel and South Africa, measurements for these systems are often given in metric units of centimeters or millimeters. Second, know the system. **Drip irrigation systems** require a backflow preventer in order to keep the water line free from pathogens and debris. In addition, all piping should be of the same size in order to prevent leaks or the drip tubes from working their way loose. Your particular needs and the water flow required will help determine if a buried system or a top-mounted system is best for your particular needs. Drip irrigation systems can lower the height of your septic drain field mound and allow for efficient reuse of the wastewater. These systems are cost-effective and provide beneficial reuse for landscape irrigation. At Southern Water and Soil, we have everything your property needs to promote the best water quality and soil health in Odessa, FL. [Give us a call](/contact-southern-water-and-soil/) today! --- ### [Commercial Real Estate Septic Inspections, Tampa, FL](https://southernsepticanddesign.com/septic-services-tampa-fl/commercial-real-estate-septic-inspections/) **Published:** July 2, 2020 **Author:** Southern Water Soil **Content:** ## We recommend buyers, sellers, and others consider commercial real estate septic inspections. At Southern Water and Soil, we are proud to be a highly regarded commercial septic services provider serving the Tampa, Florida area. While the vast majority of our customers call us for commercial maintenance, repairs, installations, and replacements, we want you to know that we are also here for you when it comes time to purchase or sell a property that has a septic system. Our **commercial real estate septic inspections** are an important part of any commercial real estate transaction, so you can have peace of mind that you have all the pertinent facts about the age and condition of the septic system. ![Commercial Real Estate Septic Inspections in Tampa, Florida](https://southernsepticanddesign.com/wp-content/uploads/2020/07/2011-08-01-16.05.20-1.jpg) As a seller, you would prefer not to have any surprises come up during the due diligence period that could sour your buyer’s interest. **Commercial real estate septic inspections** can be a strong selling point, as well, as it shows your dedication to taking care of the property and selling it with a clean bill of health, so to speak. As a buyer, if the seller has not provided you with a recent inspection report, you should call us to learn about commercial real estate septic inspections. You will likely have a general inspector look over the property and while that is a great idea, they won’t be as thorough with the septic system inspection as we will be. It is far better to learn of a problem before you close when you are in the position of renegotiating if it requires major repairs or replacement. Even if you are neither a buyer nor a seller, commercial real estate septic inspections are important. We can catch problems when they are more affordable to resolve rather than wait for a major failure and backup that could halt your business operations. [Call today](/contact-southern-water-and-soil/) to schedule an appointment for an inspection and have peace of mind that all is well. --- *At Southern Water and Soil, we perform **commercial real estate septic inspections** in Brooksville, [Dade City](/septic-services-dade-city-fl/commercial-real-estate-septic-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, [Orlando](/septic-services-orlando-fl/commercial-real-estate-septic-inspections/), Plant City, Spring Hill, and **[Tampa](/septic-services-tampa-fl/commercial-real-estate-septic-inspections/)**, Florida.* --- ### [Basin Management Action Plan, Fort Meyers, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-fort-myers-fl/basin-management-action-plan/) **Published:** December 14, 2023 **Author:** Southern Water Soil **Content:** ## Our team provides effective basin management planning services to help you protect the local environment. Here in Florida, water flow and management are major concerns for every construction company, developer, and even the average homeowner. The state is essentially just a big sponge made of limestone, with water filling every pore. Because of this, it’s important to be especially careful to make sure contaminants don’t get into the ground because they will inevitably get into the water, too. One example of the kinds of problems that can occur is runoff from septic systems causing algal blooms in nearby rivers and lakes—the extra nitrogen from the septic system causes the algae to grow rapidly. Fortunately, our team at Southern Water and Soil has the necessary experience to prevent these problems with a solid **basin management action plan**. ![Basin Management Action Plan in Fort Meyers, Florida](/wp-content/uploads/2023/06/20230623_151602-res.jpg) We have the right knowledge and experience to create an effective basin management action plan for your property, one that provides both short- and long-term protection against pollutant loading. Whether you want to take preventative measures or need help dealing with a problem in your current septic setup, you can count on us to provide the solutions you are looking for. We will identify the source of any pollution present, the type of pollutants involved, and create and implement strategies to reduce pollutant loads and keep the local water system healthy. Our team is proud to be a part of the community here in **Fort Meyers, Florida**, and we want to help you with all your water management needs. If you are looking for a team you can count on to develop and implement an effective **basin management action plan**, just [give us a call](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we create **basin management action plans** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/basin-management-action-plan/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/basin-management-action-plan/), [**Fort Myers**](/nitrogen-reducing-septic-system-fort-myers-fl/basin-management-action-plan/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/nitrogen-reducing-septic-system-florida/basin-management-action-plan/).* --- ### [Basin Management Action Plan, Florida](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-florida/basin-management-action-plan/) **Published:** August 21, 2023 **Author:** Southern Water Soil **Content:** ## We can handle basin management action plan creation and implementation. A **basin management action plan** is designed to fix water quality problems in certain areas. It is a group effort that includes local and **Florida** government agencies. The action plan aims to help sustainably restore, protect, and control water resources. At Southern Water and Soil, we have over 30 years of experience in the septic industry, including developing basin management action plans. The following must be considered to create a successful plan. ![Basin Management Action Plan in Florida](/wp-content/uploads/2023/06/20230623_151602-res.jpg) 1. **Identification.** It’s essential to assess where the pollution is coming from and how much pollution has occurred. This takes an experienced team familiar with creating a basin management action plan in order to ensure all bases are covered. 2. **Determination.** Based on a review of the pollution sources, action plans are created for each one. Some of these tactics could be changes in land use, better sewage treatment facilities, steps to stop erosion, and a push for the best management practices in agriculture. Additionally, installing a nitrogen-reducing septic system can help reduce pollutant levels. Our team is not only experienced with this type of system, but we can install it according to the conditions of the plan. 3. **Implementation and Identification.** Once the previous steps are completed, it’s essential to implement a monitoring system to ensure the plan is followed and that progress is made toward the end goal. We can provide a detailed plan describing how each part of the action plan will be put into place, including who is in charge, the timeline, the budget, and the resources needed. In short, a **basin management action plan** is a way to solve problems with water quality in a particular area by working together. Our team can develop these plans and install the necessary system to remedy the situation. [Contact us today](/contact-southern-water-and-soil/) to learn more. --- *At Southern Water and Soil, we create **basin management action plans** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/basin-management-action-plan/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/basin-management-action-plan/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/basin-management-action-plan/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, **[Florida](/nitrogen-reducing-septic-system-florida/basin-management-action-plan/)**.* --- ### [Basin Management Action Plan, Brooksville, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-brooksville-fl/basin-management-action-plan/) **Published:** November 2, 2023 **Author:** Southern Water Soil **Content:** ## Each basin management action plan we help implement is customized to the needs of the watershed. The quality of the water on your property plays a significant role in your safety and comfort, as well as the environment surrounding it. And when you have a septic system, the risk of contaminants may be higher, especially when high amounts of nitrogen can increase the risk of algae overgrowth. To protect your property and those surrounding it, you may need to take steps to reduce these risks. But where do you start? At Southern Water and Soil, our team can implement the **basin management action plan**, designed to reduce pollutant loading. ![Basin Management Action Plan in Brooksville, Florida](/wp-content/uploads/2023/06/20230623_151602-res.jpg) We are experts in short- and long-term solutions that reduce pollutants in the water on properties in and around **Brooksville, Florida**. Over the many years we have been in business, we have implemented many plans for environmentally conscious property owners, as well as people facing issues with their existing setups. Each basin management action plan we implement is customized to the needs of the watershed. We take various factors into account, such as water quality concerns, land use, the sources of pollutants, geography, and hydrology. Our **basin management action plan** implementation process includes the following steps: - Identifying the pollution source and strength - Quantifying the extent of the pollution - Designing the best system to achieve goals - Selecting the most effective septic solutions and strategies to reduce pollutant loads - Creating a program to measure the progress - Identifying any resources to help the plan go smoothly We might recommend installing a nitrogen-reducing septic system, which supports the reduction of pollutants in wastewater. Our technicians can also implement other strategies based on your property and budget, so simply [contact us](/contact-southern-water-and-soil/) for more information. --- *At Southern Water and Soil, we create **basin management action plans** in [**Brooksville**](/nitrogen-reducing-septic-system-brooksville-fl/basin-management-action-plan/), [Dade City](/nitrogen-reducing-septic-system-dade-city-fl/basin-management-action-plan/), [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/basin-management-action-plan/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/nitrogen-reducing-septic-system-florida/basin-management-action-plan/).* --- ### [Basin Management Action Plan, Dade City, FL](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-dade-city-fl/basin-management-action-plan/) **Published:** June 28, 2023 **Author:** Southern Water Soil **Content:** ## We can devise and implement basin management action plans. A **basin management action plan** outlines how to restore water quality in alignment with local and state initiatives. Typically, a basin management action plan is created to reduce pollutant loading through short- and long-term strategies. These plans typically include a comprehensive set of solutions to reduce pollutants by a total amount over a specific period of time. For example, these solutions may include putting permit limits on wastewater facilities or instituting urban and agricultural management practices that are more environmentally conscious. ![Nutrient-Reducing Septic Systems Required in Florida](https://southernsepticanddesign.com/wp-content/uploads/2023/06/20230623_151602-feat.jpg) Every basin management action plan has different solutions and strategies included to account for differences with land use, water quality problems, geography, hydrology, pollutant sources, and available economic resources. To create a basin management action plan, the following steps must occur: - Identify the source of the pollution and quantify how much pollution is occurring - Determine who is responsible for reducing the amount of pollution in a given area - Determine which strategies and projects can help reduce pollutant loads - Implement a monitoring program that will measure the progress occurring - Identify which financial resources are available to take the actions included in the plan One action that can help reduce pollutant levels in the **Dade City, Florida** area is the installation of nitrogen-reducing septic systems, also known as Enhanced Nutrient-Reducing septic systems, Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal Systems (ENR-OSTDS), or ENR septic systems. At Southern Water and Soil, we can install these systems as dictated by a basin management action plan, and we have extensive experience installing systems that support reducing pollutants in local water. [Contact us today](/contact-southern-water-and-soil/) to learn more about how we can support your **basin management action plan** with the installation of alternative septic system options. --- *At Southern Water and Soil, we create **basin management action plans** in [Brooksville](/nitrogen-reducing-septic-system-brooksville-fl/basin-management-action-plan/), **[Dade City](/nitrogen-reducing-septic-system-dade-city-fl/basin-management-action-plan/)**, [Fort Myers](/nitrogen-reducing-septic-system-fort-myers-fl/basin-management-action-plan/), Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, Spring Hill, and Tampa, [Florida](/nitrogen-reducing-septic-system-florida/basin-management-action-plan/).* --- ### [NSF 245 Septic Systems, Florida](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-florida/nsf-245-septic-systems-florida/) **Published:** June 29, 2023 **Author:** Southern Water Soil **Content:** ## We can install a nitrogen-reducing septic system on your property. When wastewater leaves your home, it’s treated in your drain field. But when water gets absorbed into your drain field and back into the groundwater, this process doesn’t remove nitrogen, which is a common byproduct in human waste. When high levels of nitrogen get into groundwater and other water sources, it can have devastating effects on the natural environment. If you are interested in installing a nitrogen-reducing septic system — also known as an Enhanced Nutrient-Reducing septic system, Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal System (ENR-OSTDS), or ENR septic system — on your property in **Florida** to control the level of nitrogen in your area, we highly recommend **NSF 245 septic systems**. At Southern Water and Soil, we have installed NSF 245 septic systems at many homes and businesses successfully, and we are impressed by the way they effectively and efficiently remove nitrogen during the wastewater removal process. ![](https://southernsepticanddesign.com/wp-content/uploads/2023/06/20230517_120215-cover.jpg) When you turn to us and tell us you want to put a nitrogen-reducing septic system on your property, the first thing we will do is explore your options with you. Then, once you have tentatively decided on a system, we will survey your property and make plans for installation. On the day of installation, our crews will arrive ready to work and install your new septic system with precision. We would be happy to answer any questions you have about **NSF 245 septic systems**, how they work, and why they are a worthwhile investment. To set up an appointment with a member of our team or to find out more about nitrogen-reducing septic systems regardless of where you’re located in Florida, [get in touch with us today](/contact-southern-water-and-soil/). --- ### [Basin Management Action Plan, Florid](https://southernsepticanddesign.com/nitrogen-reducing-septic-system-florida/basin-management-action-plan-florida/) **Published:** June 29, 2023 **Author:** Southern Water Soil **Content:** ## We can devise and implement basin management action plans. A **basin management action plan** outlines how to restore water quality in alignment with local and state initiatives. Typically, a basin management action plan is created to reduce pollutant loading through short- and long-term strategies. These plans typically include a comprehensive set of solutions to reduce pollutants by a total amount over a specific period of time. For example, these solutions may include putting permit limits on wastewater facilities or instituting urban and agricultural management practices that are more environmentally conscious. ![Nutrient-Reducing Septic Systems Required in Florida](https://southernsepticanddesign.com/wp-content/uploads/2023/06/20230623_151602-feat.jpg) Every basin management action plan has different solutions and strategies included to account for differences with land use, water quality problems, geography, hydrology, pollutant sources, and available economic resources. To create a basin management action plan, the following steps must occur: - Identify the source of the pollution and quantify how much pollution is occurring - Determine who is responsible for reducing the amount of pollution in a given area - Determine which strategies and projects can help reduce pollutant loads - Implement a monitoring program that will measure the progress occurring - Identify which financial resources are available to take the actions included in the plan One action that can help reduce pollutant levels all over **Florida** is the installation of nitrogen-reducing septic systems, also known as Enhanced Nutrient-Reducing septic systems, Enhanced Nutrient-Reducing Onsite Sewage Treatment and Disposal Systems (ENR-OSTDS), or ENR septic systems. At Southern Water and Soil, we can install these systems as dictated by a basin management action plan, and we have extensive experience installing systems that support reducing pollutants in local water. [Contact us today](/contact-southern-water-and-soil/) to learn more about how we can support your **basin management action plan** with the installation of alternative septic system options. --- ### [We are Septic Design & Engineering Experts!](https://southernsepticanddesign.com/septic-experts-florida-wastewater/) **Published:** June 13, 2023 **Author:** Southern Water Soil **Content:** ## We Are Septic Design & Engineering Experts! # We Specialize in Projects Here in Florida! We specialize in the most up-to-date septic treatment systems and designs for residential projects. We have decades of experience engineering, designing, and installing septic systems that specifically address the site, soil, and regulations unique to every job while providing well-built, long-lasting systems. One of our mottos is that we always do the work right the first time. [Contact Us](#contact-section) The state of Florida has passed a mandate to provide a significant reduction in the level of pollutants in the watershed, which impacts the excess nutrients coming from septic tanks. What this means for many home & business owners is that thousands of existing septic systems are vulnerable to failure or compromise, which can directly impact current groundwater conditions. And that may mean an update or redesign of what you already have for wastewater disposal. While this may seem complicated, the good news is that we have you covered. We are experts in a range of solutions that meet or exceed the new standards for septic systems, including: N NSF-245 septic systems N Norweco septic systems N Fuji Clean septic systems N Geoflow Drip septic systems ## Ready to get started? Fill out our Job Requisition Form. [Let's Go!](https://southernsepticanddesign.com/septic-design-engineering-requisition-for-commercial-customers/) ![Southern Septic and Design in Florida](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/06/iStock-1411368485-testimonial-res.jpg?lossy=1&strip=0&webp=1) “I had Greg and his team install a completely new system at my house. The crew that did the job were fantastic. I even accidentally caused some damage to my drain field and Greg immediately came out and fixed my mistake. Quality work that they stand behind for a fair price. Highly recommend.” ![](https://b593516.assetcdn.net/593516/wp-content/uploads/2023/06/5stars.png?lossy=1&strip=0&webp=1) -John J., Google review #### Still have questions? Contact Us for Septic Design & Engineering information Regardless of the size, regulations, or specifics of your septic job, make us your first call. While there are cheaper options out there, our warranty packages and promise to deliver quality work are worth the peace of mind. ![Septic Design & Engineering Experts](data:image/svg+xml;base64,PHN2ZyB3aWR0aD0iMSIgaGVpZ2h0PSIxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==) "\*" indicates required fields Δ Your Name\* Your Email\* Phone No.\* Address\* City\* Zip Code\* Your Message\* --- ### [Job Requisition Form](https://southernsepticanddesign.com/job-requisition-form/) **Published:** June 13, 2023 **Author:** Southern Water Soil **Content:** ## Please fill in all fields, and upload the requested files. We’ll get back to you within \_\_ business days. ## Job Order Form - SWS template Δ This field is hidden when viewing the form ### Next Steps: Sync an Email Add-On To get the most out of your form, we suggest that you sync this form with an email add-on. To learn more about your email add-on options, visit the following page (https://www.gravityforms.com/the-8-best-email-plugins-for-wordpress-in-2020/). Important: Delete this tip before you publish the form. ### JOB ORDER FORM What type of job are you requesting? Permit for New Septic Construction Permit for Septic Repair DOH Submittal Permit for Existing Septic (additions) Soil Evaluation Engineering Other Your Name(Required) First Last Your Company Name Your Client Name Property Address(Required) Street Address Address Line 2 City State AlabamaAlaskaAmerican SamoaArizonaArkansasCaliforniaColoradoConnecticutDelawareDistrict of ColumbiaFloridaGeorgiaGuamHawaiiIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaNorthern Mariana IslandsOhioOklahomaOregonPennsylvaniaPuerto RicoRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUtahU.S. Virgin IslandsVermontVirginiaWashingtonWest VirginiaWisconsinWyomingArmed Forces AmericasArmed Forces EuropeArmed Forces Pacific ZIP Code Mobile Phone(Required) Your Email Address(Required) Office Phone Fax Billing Address(Required) Street Address Address Line 2 City State AlabamaAlaskaAmerican SamoaArizonaArkansasCaliforniaColoradoConnecticutDelawareDistrict of ColumbiaFloridaGeorgiaGuamHawaiiIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaNorthern Mariana IslandsOhioOklahomaOregonPennsylvaniaPuerto RicoRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUtahU.S. Virgin IslandsVermontVirginiaWashingtonWest VirginiaWisconsinWyomingArmed Forces AmericasArmed Forces EuropeArmed Forces Pacific ZIP Code Lot Block Subdivision Platted Property ID or Folio # Property size Type of Establishment Single Family Residential Commercial MHP Industrial/Manufacturing School Church Other Heated sq footage Number of Bedrooms ### Please describe what the structure is used for (i.e., meeting hall, warehouse, office, home, shed, etc.) Preferred Method of ContactEmailPhone Best Time to Reach You(Required)Select A Time12:00 am12:30 am1:00 am1:30 am2:00 am2:30 am3:00 am3:30 am4:00 am4:30 am5:00 am5:30 am6:00 am6:30 am7:00 am7:30 am8:00 am8:30 am9:00 am9:30 am10:00 am10:30 am11:00 am11:30 am12:00 pm12:30 pm1:00 pm1:30 pm2:00 pm2:30 pm3:00 pm3:30 pm4:00 pm4:30 pm5:00 pm5:30 pm6:00 pm6:30 pm7:00 pm7:30 pm8:00 pm8:30 pm9:00 pm9:30 pm10:00 pm10:30 pm11:00 pm11:30 pm Additional Comments/Questions(Required) Address(Required) Street Address Address Line 2 City State / Province / Region ZIP / Postal Code Country AfghanistanAlbaniaAlgeriaAmerican SamoaAndorraAngolaAnguillaAntarcticaAntigua and BarbudaArgentinaArmeniaArubaAustraliaAustriaAzerbaijanBahamasBahrainBangladeshBarbadosBelarusBelgiumBelizeBeninBermudaBhutanBoliviaBonaire, Sint Eustatius and SabaBosnia and HerzegovinaBotswanaBouvet IslandBrazilBritish Indian Ocean TerritoryBrunei DarussalamBulgariaBurkina FasoBurundiCabo VerdeCambodiaCameroonCanadaCayman IslandsCentral African RepublicChadChileChinaChristmas IslandCocos IslandsColombiaComorosCongoCongo, Democratic Republic of theCook IslandsCosta RicaCroatiaCubaCuraçaoCyprusCzechiaCôte d'IvoireDenmarkDjiboutiDominicaDominican RepublicEcuadorEgyptEl SalvadorEquatorial GuineaEritreaEstoniaEswatiniEthiopiaFalkland IslandsFaroe IslandsFijiFinlandFranceFrench GuianaFrench PolynesiaFrench Southern TerritoriesGabonGambiaGeorgiaGermanyGhanaGibraltarGreeceGreenlandGrenadaGuadeloupeGuamGuatemalaGuernseyGuineaGuinea-BissauGuyanaHaitiHeard Island and McDonald IslandsHoly SeeHondurasHong KongHungaryIcelandIndiaIndonesiaIranIraqIrelandIsle of ManIsraelItalyJamaicaJapanJerseyJordanKazakhstanKenyaKiribatiKorea, Democratic People's Republic ofKorea, Republic ofKuwaitKyrgyzstanLao People's Democratic RepublicLatviaLebanonLesothoLiberiaLibyaLiechtensteinLithuaniaLuxembourgMacaoMadagascarMalawiMalaysiaMaldivesMaliMaltaMarshall IslandsMartiniqueMauritaniaMauritiusMayotteMexicoMicronesiaMoldovaMonacoMongoliaMontenegroMontserratMoroccoMozambiqueMyanmarNamibiaNauruNepalNetherlandsNew CaledoniaNew ZealandNicaraguaNigerNigeriaNiueNorfolk IslandNorth MacedoniaNorthern Mariana IslandsNorwayOmanPakistanPalauPalestine, State ofPanamaPapua New GuineaParaguayPeruPhilippinesPitcairnPolandPortugalPuerto RicoQatarRomaniaRussian FederationRwandaRéunionSaint BarthélemySaint Helena, Ascension and Tristan da CunhaSaint Kitts and NevisSaint LuciaSaint MartinSaint Pierre and MiquelonSaint Vincent and the GrenadinesSamoaSan MarinoSao Tome and PrincipeSaudi ArabiaSenegalSerbiaSeychellesSierra LeoneSingaporeSint MaartenSlovakiaSloveniaSolomon IslandsSomaliaSouth AfricaSouth Georgia and the South Sandwich IslandsSouth SudanSpainSri LankaSudanSurinameSvalbard and Jan MayenSwedenSwitzerlandSyria Arab RepublicTaiwanTajikistanTanzania, the United Republic ofThailandTimor-LesteTogoTokelauTongaTrinidad and TobagoTunisiaTurkmenistanTurks and Caicos IslandsTuvaluTürkiyeUS Minor Outlying IslandsUgandaUkraineUnited Arab EmiratesUnited KingdomUnited StatesUruguayUzbekistanVanuatuVenezuelaViet NamVirgin Islands, BritishVirgin Islands, U.S.Wallis and FutunaWestern SaharaYemenZambiaZimbabweÅland Islands --- ### [Orenco AdvanTex AX-Max, Mooresville, NC](https://southernsepticanddesign.com/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/) **Published:** July 11, 2016 **Author:** Southern Water Soil **Content:** ## Using the Orenco AdvanTex AX-Max system allows Mooresville communities to experience significant energy savings without managing extensive maintenance. ![Orenco AdvanTex AX-Max in Mooresville, North Carolina](/wp-content/uploads/2016/07/IMAG1278-resized-300x169.jpg)Ideal for residential and commercial communities, the **Orenco AdvanTex AX-Max** system is one of the wastewater treatment systems we offer at Southern Water and Soil. This system comes with a fully plumbed, modular treatment plant that can handle flows of up to 1 MGD. The Orenco AdvanTex AX-Max can also be installed below or above ground, and it is built inside of a watertight, durable, lightweight fiberglass tank. If you are interested in having one of these wastewater treatment systems installed at your location in Mooresville, North Carolina, we would be more than happy to introduce you to its many advantageous features. For example, this system comes with proven AdvanTex technology that allows it to be designed to meet certain nutrient limits and re-use standards. Thanks to its modular design, communities can also defer the operational costs that come from using one of these systems until revenue is generated. When it comes down to it, using the **Orenco AdvanTex AX-Max** system allows communities to experience significant energy savings without managing extensive maintenance. This makes it an ideal solution for cities with an operational staff that is available part-time. At Southern Water and Soil, we are ready and waiting to get started on the design and installation of your new wastewater treatment system. [Reach out to us](/contact-southern-water-and-soil/) today to find out more about the Orenco AdvanTex AX-Max system and its many benefits. --- *At Southern Water and Soil, we install **Orenco AdvanTex AX-Max** systems in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/), **[Fort Myers](/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/)**, [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/), [Lutz](/package-plant-installations-lutz-fl/orenco-advantex-ax-max/), [Miami](/package-plant-installations-miami-fl/orenco-advantex-ax-max/), [Odessa](/package-plant-installations-odessa-fl/orenco-advantex-ax-max/), [Orlando](/package-plant-installations-orlando-fl/orenco-advantex-ax-max/), Plant City, Spring Hill, and [Tampa](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/), Florida.* --- ### [Orenco AdvanTex AX-Max, Orlando, FL](https://southernsepticanddesign.com/package-plant-installations-orlando-fl/orenco-advantex-ax-max/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## The Orenco AdvanTex AX-Max system allows your community in Orlando to enjoy easy monitoring and maintenance. ![Orenco AdvanTex AX-Max in Orlando, Florida](/wp-content/uploads/2016/10/IMAG1278-resized.jpg)If your community in Orlando, Florida is looking for a wastewater treatment solution that provides enhancements and alternatives to the traditional gravity wastewater systems, the **Orenco AdvanTex AX-Max** system is had numerous advantages. At Southern Water and Soil, we have over 30 years of experience in designing, installing and maintaining septic systems, and we are equipped to assist you if you have determined the Orenco system meets your needs. There are numerous advantages to the Orenco AdvanTex AX-Max wastewater treatment system, including: - Great for small to mid-size communities that may not have a full-time operational staff - Provides energy savings and easy maintenance for wastewater treatment - Has proven and reliable packed-bed media filter technology - Designs meet strict re-use standards or nutrient limits - Option for deferred costs until flow and revenue are generated due to its modular design - Designed for surface discharge, dust control, and other reuse applications - Fully plumbed and can be installed above or below ground - Handles flows up to 1 MGD (million gallons divided) - Ideal for residential and commercial applications Additionally, the **Orenco AdvanTex AX-Max** system features telemetry controls and advanced nutrient disinfection and removal options, so your community can enjoy easy monitoring and maintenance. At Southern Water and Soil, we know the advantages this modular system can offer your community in Orlando. If you have questions about the advantages of this system or would like to work with us, please [contact us](/contact-southern-water-and-soil/) today. Our highly trained team has over 30 years of combined experience, and we always work to exceed customer expectations. --- *At Southern Water and Soil, we install **Orenco AdvanTex AX-Max** systems in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/), [Fort Myers](/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/), [Lutz](/package-plant-installations-lutz-fl/orenco-advantex-ax-max/), [Miami](/package-plant-installations-miami-fl/orenco-advantex-ax-max/), [Odessa](/package-plant-installations-odessa-fl/orenco-advantex-ax-max/), **[Orlando](/package-plant-installations-orlando-fl/orenco-advantex-ax-max/)**, Plant City, Spring Hill, and [Tampa](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/), Florida.* --- ### [Orenco AdvanTex AX-Max, Tampa, FL](https://southernsepticanddesign.com/package-plant-installations-tampa-fl/orenco-advantex-ax-max/) **Published:** February 17, 2016 **Author:** Southern Water Soil **Content:** ## The Orenco AdvanTex AX-Max system is an ideal solution for residential and commercial communities in Tampa, FL. ![Orenco AdvanTex AX-Max](/wp-content/uploads/2016/02/IMAG1278-resized1-300x169.jpg)At Southern Water and Soil, we are proud to offer the **Orenco AdvanTex AX-MAX** system. This system features a modular, fully-plumbed treatment plant that is capable of handling flows up to 1 MGD, making it an ideal wastewater collection and treatment option for commercial and residential communities. This system can either be installed above or below ground and is built inside of a fiberglass tank that is watertight, lightweight, and durable. With one of these systems, communities also have the option to install the system singly or using multi-tank arrays. If a community chooses a multi-tank array configuration, this aspect of the system can be enclosed within a building. **Features of the Orenco AdvanTex AX-Max** This wastewater treatment system comes equipped with many different advantageous features. These include: - **Proven AdvanTex technology—**The Orenco AdvanTex AX-Max has been chosen for thousands of installations throughout the world because of its proven and reliable packed bed media filter technology. Thanks to this technology, these systems can be designed to meet strict re-use standards or nutrient limits. - **Phased buildout—**Communities can defer the majority of the costs of using one of these systems until flow and revenue are generated, thanks to its modular design. - **Re-use applications—**The Orenco AdvanTex AX-MAX is suited for dust control, surface discharge, and other reuse applications because it features advanced nutrient disinfection and removal options complemented by telemetry controls. With the **Orenco AdvanTex AX-MAX** system, communities can enjoy significant energy savings and efficient maintenance. This makes this wastewater treatment system an ideal solution for small municipalities in Tampa, Florida that only have a part-time operational staff. **Contact Us Today** Our team here at Southern Water and Soil is ready and waiting to discuss your project’s needs. [Contact us](/contact-southern-water-and-soil/) today to find out more about the Orenco AdvanTex AX-MAX system and how it could benefit your community. --- *At Southern Water and Soil, we install **Orenco AdvanTex AX-Max** systems in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/), [Fort Myers](/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/), [Lutz](/package-plant-installations-lutz-fl/orenco-advantex-ax-max/), [Miami](/package-plant-installations-miami-fl/orenco-advantex-ax-max/), [Odessa](/package-plant-installations-odessa-fl/orenco-advantex-ax-max/), [Orlando](/package-plant-installations-orlando-fl/orenco-advantex-ax-max/), Plant City, Spring Hill, and **[Tampa](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/)**, Florida.* --- ### [Orenco AdvanTex AX-Max, Odessa, FL](https://southernsepticanddesign.com/package-plant-installations-odessa-fl/orenco-advantex-ax-max/) **Published:** March 29, 2016 **Author:** Southern Water Soil **Content:** ## We are proud to offer the Orenco AdvanTex AX-Max system to residential and commercial locations in Odessa, FL. ![Orenco AdvanTex AX-Max](/wp-content/uploads/2016/03/2013-08-22-20.05.34-resized-300x169.jpg)Featuring a modular, fully plumbed treatment plan that is capable of handling flows up to 1 MGD, our team at Southern Water and Soil is proud to offer the **Orenco AdvanTex AX-Max** system. Thanks to its impressive capabilities, not only is this wastewater collection and treatment system an ideal solution for residential communities, but it is also often a beneficial fit for commercial locations. One of the key features of the Orenco AdvanTex AX-Max system is its proven technology. For thousands all over the world, this system has become the system of choice because of its reliable packed bed media filter. As a result of this technology, systems like these can meet strict nutrient limits or re-use standards. Communities in Odessa, Florida can also defer the majority of the building costs associated with using one of these systems until revenue and unit flow are generated due to their modular design. If you are interested in using an Orenco AdvanTex AX-Max system, please keep in mind that these systems can either be built below or above ground. These systems, which feature a lightweight, durable fiberglass tank, can also be installed singly or using multi-tank arrays. At Southern Water and Soil, our team is always ready and waiting to discuss the needs of your project. For more information about the **Orenco AdvanTex AX-Max** System, how it works, and if it is the right fit for your community, please [contact us](/contact-southern-water-and-soil/) today. --- *At Southern Water and Soil, we install **Orenco AdvanTex AX-Max** systems in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/), [Fort Myers](/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/), [Lutz](/package-plant-installations-lutz-fl/orenco-advantex-ax-max/), [Miami](/package-plant-installations-miami-fl/orenco-advantex-ax-max/), **[Odessa](/package-plant-installations-odessa-fl/orenco-advantex-ax-max/)**, [Orlando](/package-plant-installations-orlando-fl/orenco-advantex-ax-max/), Plant City, Spring Hill, and [Tampa](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/), Florida.* --- ### [Orenco AdvanTex AX-Max, Miami, FL](https://southernsepticanddesign.com/package-plant-installations-miami-fl/orenco-advantex-ax-max/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## The Orenco AdvanTex AX-Max system offers a number of advantages for residents of Miami. ![Orenco AdvanTex AX-Max in Miami, Florida](/wp-content/uploads/2016/10/IMAG1278-resized1.jpg)At Southern Water and Soil, we partner with Orenco to provide wastewater treatment solutions for small and medium-sized communities that provide enhancements and alternatives to traditional gravity wastewater management systems. The **Orenco AdvanTex AX-Max** system offers communities a number of advantages, and our team is equipped to assist you with the design, installation and maintenance, so you achieve the best results in Miami, FL. The Orenco AdvanTex AX-Max system offers a number of advantages, including easy operation for communities that may not have full-time operational staff. This wastewater treatment system not only provides easy maintenance, but also energy savings while meeting strict re-use standards and nutrient limits. The Orenco AdvanTex AX-Max system has a proven and reliable packed-bed media filter technology and is designed for surface discharge, dust control, and other reuse applications. This system is fully plumbed, can be installed above or below-ground, and can handle flows up to 1 MGD (million gallons divided). With the option to defer costs until flow and revenue are generated due to its modular design, the **Orenco AdvanTex AX-Max** system is ideal for both residential and commercial applications. Your community may also be interested in system features like telemetry controls and advanced nutrient disinfection and removal options so you enjoy easy monitoring and maintenance. If you have questions about the advantages of this system or would like to work with us at Southern Water and Soil, please [contact us](/contact-southern-water-and-soil/) today. The Orenco AdvanTex AX-Max system offers many advantages, and we are ready to discuss your needs. --- *At Southern Water and Soil, we install **Orenco AdvanTex AX-Max** systems in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/), [Fort Myers](/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/), [Lutz](/package-plant-installations-lutz-fl/orenco-advantex-ax-max/), **[Miami](/package-plant-installations-miami-fl/orenco-advantex-ax-max/)**, [Odessa](/package-plant-installations-odessa-fl/orenco-advantex-ax-max/), [Orlando](/package-plant-installations-orlando-fl/orenco-advantex-ax-max/), Plant City, Spring Hill, and [Tampa](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/), Florida.* --- ### [Orenco AdvanTex AX-Max, Lutz, FL](https://southernsepticanddesign.com/package-plant-installations-lutz-fl/orenco-advantex-ax-max/) **Published:** February 22, 2016 **Author:** Southern Water Soil **Content:** ## The Orenco AdvanTex AX-Max is an advantageous wastewater treatment solution for residential and commercial communities in Lutz, FL. ![Orenco AdvanTex AX-Max](/wp-content/uploads/2016/02/IMAG1278-resized1-300x169.jpg)If you are looking for a new wastewater collection and treatment system, at Southern Water and Soil, we highly recommend the **Orenco AdvanTex AX-Max** system. This system, which features a modular, fully plumbed treatment plan, can manage flows up to 1 MGD. This ultimately makes it an ideal option for both residential and commercial communities. If you decide to go with the Orenco AdvanTex AX-Max system, you can either install it above or below ground, thanks to its watertight, durable, and lightweight fiberglass tank. You also have the option to go with a multi-tank array configuration, which allows you to enclose it within a building. The Orenco AdvanTex AX-Max also comes with many other advantageous features. For example, this system continues to be very popular because of its reliable packed bed media filter technology, which allows these systems to meet stringent nutrient limits or re-use standards. With one of these systems, communities can also defer the majority of costs until revenue is generated due to the modular design it comes with. Finally, the **Orenco AdvanTex** AX-Max can be used for a variety of reuse applications because it comes with nutrient disinfection and removal options along with innovative telemetry controls. Our team at Southern Water and Soil is ready and waiting to discuss your Lutz, Florida community’s wastewater and treatment needs. [Contact us](/contact-southern-water-and-soil/) today to set up a consultation to find out if the Orenco AdvanTex AX-Max is the right solution for your location. --- *At Southern Water and Soil, we install **Orenco AdvanTex AX-Max** systems in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/), [Fort Myers](/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/), **[Lutz](/package-plant-installations-lutz-fl/orenco-advantex-ax-max/)**, [Miami](/package-plant-installations-miami-fl/orenco-advantex-ax-max/), [Odessa](/package-plant-installations-odessa-fl/orenco-advantex-ax-max/), [Orlando](/package-plant-installations-orlando-fl/orenco-advantex-ax-max/), Plant City, Spring Hill, and [Tampa](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/), Florida.* --- ### [Orenco AdvanTex AX-Max, Land O’ Lakes, FL](https://southernsepticanddesign.com/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/) **Published:** June 7, 2016 **Author:** Southern Water Soil **Content:** ## We are equipped to answer your questions and assist with the design and installation of the Orenco AdvanTex AX-Max system in Land O’ Lakes. ![Orenco AdvanTex AX-Max in Land O’ Lakes, Florida](/wp-content/uploads/2016/02/IMAG1278-resized1-300x169.jpg)The **Orenco AdvanTex AX-Max** system is the perfect solution for communities that would like to enjoy energy savings and easy maintenance for their wastewater treatment. Great for small to mid-size communities in Land O’ Lakes, Florida that may not have a full time operational staff, the Orenco system has numerous advantages. At Southern Water and Soil, we are equipped to answer your questions and assist with the design and installation of this system to meet your needs. We know you will enjoy the Orenco AdvanTex AX-Max system because of its proven and reliable packed bed media filter technology and a design meeting strict re-use standards or nutrient limits. Your community may also be able to defer the majority of the costs associated with using this system until flow and revenue are generated due to its modular design. Additionally, the Orenco AdvanTex system is designed for surface discharge, dust control, and other reuse applications. This wastewater system features telemetry controls and advanced nutrient disinfection and removal options. At Southern Water and Soil, we know the advantages of this modular system and believe it will offer your community the wastewater solutions it needs. The **Orenco AdvanTex AX-Max** treatment plant system is fully plumbed, can be installed above or below ground, and can handle flows up to 1 MGD (million gallons divided), making it ideal for residential and commercial applications. If you have questions about the advantages of this system or would like to work with us at Southern Water and Soil, please [contact us today](/contact-southern-water-and-soil/). Our highly trained team has over 30 years of combined experience exceeding customer expectations. --- *At Southern Water and Soil, we install **Orenco AdvanTex AX-Max** systems in Brooksville, [Dade City](/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/), [Fort Myers](/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/), **[Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/)**, [Lutz](/package-plant-installations-lutz-fl/orenco-advantex-ax-max/), [Miami](/package-plant-installations-miami-fl/orenco-advantex-ax-max/), [Odessa](/package-plant-installations-odessa-fl/orenco-advantex-ax-max/), [Orlando](/package-plant-installations-orlando-fl/orenco-advantex-ax-max/), Plant City, Spring Hill, and [Tampa](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/), Florida.* --- ### [Orenco AdvanTex AX-Max, Dade City, FL](https://southernsepticanddesign.com/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/) **Published:** March 26, 2023 **Author:** Southern Water Soil **Content:** ## The Orenco AdvanTex AX-Max system is an ideal solution for residential and commercial communities in Dade City, FL. ![Orenco AdvanTex AX-Max in Dade City, Florida](/wp-content/uploads/2016/02/IMAG1278-resized1-300x169.jpg)At Southern Water and Soil, we are proud to offer the **Orenco AdvanTex AX-MAX** system. This system features a modular, fully-plumbed treatment plant that is capable of handling flows up to 1 MGD, making it an ideal wastewater collection and treatment option for commercial and residential communities. This system can either be installed above or below ground and is built inside of a fiberglass tank that is watertight, lightweight, and durable. With one of these systems, communities also have the option to install the system singly or using multi-tank arrays. If a community chooses a multi-tank array configuration, this aspect of the system can be enclosed within a building. **Features of the Orenco AdvanTex AX-Max** This wastewater treatment system comes equipped with many different advantageous features. These include: - **Proven AdvanTex technology—**The Orenco AdvanTex AX-Max has been chosen for thousands of installations throughout the world because of its proven and reliable packed bed media filter technology. Thanks to this technology, these systems can be designed to meet strict re-use standards or nutrient limits. - **Phased buildout—**Communities can defer the majority of the costs of using one of these systems until flow and revenue are generated, thanks to its modular design. - **Re-use applications—**The Orenco AdvanTex AX-MAX is suited for dust control, surface discharge, and other reuse applications because it features advanced nutrient disinfection and removal options complemented by telemetry controls. With the **Orenco AdvanTex AX-MAX** system, communities can enjoy significant energy savings and efficient maintenance. This makes this wastewater treatment system an ideal solution for small municipalities in **Dade City, Florida** that only have a part-time operational staff. **Contact Us Today** Our team here at Southern Water and Soil is ready and waiting to discuss your project’s needs. [Contact us](/contact-southern-water-and-soil/) today to find out more about the Orenco AdvanTex AX-MAX system and how it could benefit your community. --- *At Southern Water and Soil, we install **Orenco AdvanTex AX-Max** systems in Brooksville, [**Dade City**](/package-plant-installations-dade-city-fl/orenco-advantex-ax-max/), [Fort Myers](/package-plant-installations-fort-myers-fl/orenco-advantex-ax-max/), [Land O’ Lakes](/package-plant-installations-land-o-lakes-fl/orenco-advantex-ax-max/), [Lutz](/package-plant-installations-lutz-fl/orenco-advantex-ax-max/), [Miami](/package-plant-installations-miami-fl/orenco-advantex-ax-max/), [Odessa](/package-plant-installations-odessa-fl/orenco-advantex-ax-max/), [Orlando](/package-plant-installations-orlando-fl/orenco-advantex-ax-max/), Plant City, Spring Hill, and [Tampa](/package-plant-installations-tampa-fl/orenco-advantex-ax-max/), Florida.* --- ### [Certified Commercial Septic System Inspector, Dade City, FL](https://southernsepticanddesign.com/master-septic-contractor-dade-city-fl/certified-commercial-septic-system-inspector/) **Published:** May 9, 2023 **Author:** Southern Water Soil **Content:** ## We are qualified to inspect commercial septic systems. Many commercial properties in the **Dade City, Florida** area rely on a septic system to process and treat wastewater. When you need to have your commercial septic system inspected and assessed for damage, it is important to work with a **certified commercial septic system inspector** you can trust to do the job right. ![Inspection Process for Septic Systems](/wp-content/uploads/2022/02/2012-01-26-13.05.47-res.jpg) A **certified commercial septic system inspector** is a professional who has received specialized training and certification to inspect and evaluate septic systems. A certified inspector will have extensive knowledge of the design, installation, and maintenance of septic systems. At Southern Water and Soil, we are a certified commercial septic system inspector trained to inspect septic systems and identify potential issues and areas of concern. Have us come and perform an inspection of your commercial septic system, and we will evaluate the condition of the tank, the drain field, and other components of the system. We will make sure they are functioning properly while meeting all local regulations and requirements. We recommend having a commercial septic system inspection performed before the sale or transfer of a property and periodically during the lifespan of the septic system to ensure it continues to function properly. During an inspection of your system in Dade City, we will visually inspect the system in addition to conducting various tests to assess the system’s condition. Having a certified commercial septic system inspector from our team inspect your system can provide peace of mind and help you make informed repair and replacement decisions. To learn more about our inspection process or to set up an inspection, [contact us today](/contact-southern-water-and-soil/). --- ### [Septic Upgrade Incentive Program, Dade City, FL](https://southernsepticanddesign.com/residential-septic-dade-city-fl/septic-upgrade-incentive-program/) **Published:** May 9, 2023 **Author:** Southern Water Soil **Content:** ## Upgrade your septic system with a newer or more efficient model. **Septic upgrade incentive programs** provide financial incentives to homeowners to either upgrade or replace their existing septic system with a newer, more efficient model. We stay on top of available septic upgrade incentive programs available through state and local government agencies, as well as utility companies and nonprofit organizations. ![Septic Upgrade Incentive Program in Dade City, FL](/wp-content/uploads/2019/09/2012-11-21-10.30.10-res.jpg) While **septic upgrade incentive programs** vary depending on the program, most offer financial incentives to upgrade or replace your septic system in the form of rebates, grants, or low-interest loans to help cover the cost of improving the current septic system setup. Some of the benefits of these programs include improved public health, reduced water pollution, and lower septic maintenance costs. Additionally, when you upgrade or replace your septic system, you can reduce the amount of wastewater that enters local waterways, which can help protect public and environmental health. Newer or upgraded systems are often low-maintenance and more efficient options, which can save homeowners money in the long run. If you choose to participate in a septic upgrade incentive program, we can not only provide needed details but also perform the actual upgrade work. Our team is experienced, knowledgeable, and known for providing excellent septic services. If you are interested in learning more about septic upgrade incentive programs available to homeowners here in the **Dade City, Florida** area, we are here to help. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today to learn more about current programs in your local area. --- ### [Commercial Septic, Orlando, FL](https://southernsepticanddesign.com/commercial-septic-orlando-fl/) **Published:** September 20, 2017 **Author:** Southern Water Soil **Content:** ## What makes us your first choice for commercial septic services is that we have more than 30 years of combined experience in the wastewater industry in Orlando. ![Commercial Septic in Orlando, Florida](/wp-content/uploads/2017/09/Selling-a-Business-with-a-Septic-System.jpg) At Southern Water and Soil, we often find that our customers are looking for a septic company that can handle the nuances of their commercial septic system. While many residential companies offer some commercial services, they don’t always have the experience and expertise to ensure that a commercial septic system is truly performing at the highest level. When you work with us at Southern Water and Soil, you will quickly see why we are a leading provider of **commercial septic** services, whether you need assistance with your grease trap or you are planning a new commercial septic installation for your business. Our highly qualified team is prepared to work with you at every stage of your commercial septic system design, installation, and maintenance in Orlando, Florida, and we are capable of completing any repairs that may arise as your system sees regular use. Part of what makes us your first choice for **commercial septic** services is that we have more than 30 years of combined experience in the wastewater industry. Our team is certified, trained, and knowledgeable about a variety of commercial septic systems and their unique requirements. Whatever the age, condition, or maintenance needs of your commercial septic system may be, we can handle the job without question. When it comes to price, experience, and customer satisfaction, there is no better place to turn for commercial septic solutions in Orlando. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today to learn more about our services. You’ll quickly see that you won’t need to go anywhere else. We look forward to providing the commercial wastewater services you need. --- *At Southern Water and Soil, we offer commercial septic services in Brooksville, [Dade City](/commercial-septic-brandon/), Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/), [Lutz](/commercial-septic-lutz-fl/), Miami, [Odessa](/commercial-septic-odessa-fl/), [**Orlando**](/commercial-septic-orlando-fl/), [Plant City](/commercial-septic-plant-city-fl/), Spring Hill, and [Tampa](/commercial-septic-tampa-fl/), Florida.* ### Similar Services We Offer --- ### [Commercial Septic System Design, Cornelius, NC](https://southernsepticanddesign.com/commercial-septic-cornelius-nc/commercial-septic-system-design/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ## Our goal is always to provide you with commercial septic system design services in Cornelius that exceed your expectations. ![Commercial Septic System Design, Cornelius in North Carolina](/wp-content/uploads/2016/10/Please-make-sure-to-include-this-one-2012-01-18-13.38.23-resized-300x179.jpg)When it comes to your commercial septic system design in Cornelius, North Carolina, you need a knowledgeable, reliable and professional team to handle the job. At Southern Water and Soil, we are your number one resource because we offer a number of different services as a part of **commercial septic system design**, so your community has alternatives to traditional wastewater management. Not only can we assist with the process of designing your commercial septic system, but we are also knowledgeable about a variety of different wastewater treatment systems and can discuss your needs before taking next steps for installation. We have over three decades of combined experience in the septic and wastewater industry, and we realize how important customer satisfaction is. Our goal is always to provide you with commercial septic system design services that exceed your expectations. We work to achieve wastewater solutions that help your small or mid-sized community get the best results. If you are interested in commercial septic system design and installation of effluent sewers, cluster wastewater treatment systems, package plant installations and more, our team is equipped to handle the job. We also partner with Orenco to provide high-quality wastewater systems for communities, so they have long-term, sustainable wastewater solutions. We always take the time to provide full septic services, so your system continues to run efficiently from year to year. At Southern Water and Soil, we are available to answer any questions you might have about **commercial septic system design** and give you information about the wastewater systems that may work best for you. [Contact us](/contact-southern-water-and-soil/) today to get started. We look forward to hearing from you. --- [Commercial Septic System Design in Lutz, FL](/commercial-septic-lutz-fl/commercial-septic-system-design/) [Commercial Septic System Design in Odessa, FL](/commercial-septic-odessa-fl/commercial-septic-system-design/) [Commercial Septic System Design in Land O’ Lakes, FL](/commercial-septic-land-o-lakes-fl/commercial-septic-system-design/) [Commercial Septic System Design in Tampa, FL](/commercial-septic-tampa-fl/commercial-septic-system-design/) [Commercial Septic System Design in Davidson, NC](/commercial-septic-davidson-nc/commercial-septic-system-design/) --- ### [Commercial Septic, Cornelius, NC](https://southernsepticanddesign.com/commercial-septic-cornelius-nc/) **Published:** October 24, 2016 **Author:** Southern Water Soil **Content:** ### Similar Services We Offer: --- ### [Septic Services, Orlando, FL](https://southernsepticanddesign.com/septic-services-orlando-fl/) **Published:** September 20, 2017 **Author:** Southern Water Soil **Content:** ## We provide you with the best possible commercial septic services, so you never have to worry about your wastewater management system in Orlando. ![Septic Services in Orlando, Florida](/wp-content/uploads/2017/09/Septic-Services.jpg) If you operate a business in a rural area outside of Orlando, Florida, you may enjoy the peace that comes with having a little more room and less hustle and bustle that comes with city life. You may also find yourself dealing with the requirements of property upkeep, including septic system maintenance. Your septic system is a critical part of the way wastewater is treated and safely released on your property, and that means maintaining your tank and other system components is very important. At Southern Water and Soil, we can help you manage this important task with septic services that keep your system operating well. Our team at Southern Water and Soil is highly trained and skilled to provide a variety of **septic services**, including installation, maintenance, and repair. With more than 30 years of combined experience in the commercial septic industry, there is no job we can’t handle. We believe that a great septic system begins with the right design, followed by expert installation and ongoing routine care of your tank and drain field. Our goal is to provide you with the best possible septic services, so you never have to worry that your wastewater management system isn’t doing its job. You can also rely on us to provide a variety of septic system solutions when you are experiencing unique challenges with your septic system. When you require a commercial septic company that can provide comprehensive **septic services** from initial design to complete maintenance solutions, [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil. You will see that we are your commercial septic company of choice. --- *At Southern Water and Soil, we offer **septic services** in Brooksville, [Dade City](/septic-services-brandon/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-services-odessa-fl/), **[Orlando](/septic-services-orlando-fl/)**, Plant City, Spring Hill, and [Tampa](/septic-services-tampa-fl), Florida.* --- ### [Commercial Real Estate Septic Inspections, Orlando, FL](https://southernsepticanddesign.com/septic-services-orlando-fl/commercial-real-estate-septic-inspections/) **Published:** September 20, 2017 **Author:** Southern Water Soil **Content:** ## Our commercial real estate septic inspections in Orlando include a full inspection of all septic components to ensure complete efficiency and effectiveness. If you are buying or selling a business with a septic system, or if you require routine servicing at your business location in Orlando, Florida, one of the most important services you can request is a commercial real estate inspection. At Southern Water and Soil, we find that **commercial real estate septic inspections** are critical to any business sale or purchase, and for ensuring the long-term performance of the system over time. ![Commercial Real Estate Septic Inspections in Orlando, Florida](/wp-content/uploads/2017/09/septicengineer.jpg) Whatever your reason for needing commercial real estate inspections in Orlando, you’ll find our team equipped to provide the expert inspections you require. We can fully assess the function of your commercial septic tank, it’s age and condition, and if there are any signs of disrepair that need immediate attention. Our **commercial real estate septic inspections** also include a full inspection of other septic components to ensure complete efficiency and effectiveness. We have earned our trusted reputation as a premier commercial septic company over the past 30 years by providing expert services and solutions during every phase of the septic installation, repair, and maintenance process. After our commercial real estate septic inspections, we not only provide the necessary reports and documentation of our findings, but we can also provide the required services should a septic system need immediate attention. At Southern Water and Soil, we like to stress scheduling commercial real estate septic inspections as soon as you plan to buy or sell a property in Orlando, or if you haven’t had your system serviced in some time. We are here to help you with all your commercial septic needs. --- *At Southern Water and Soil, we perform **commercial real estate septic inspections** in Brooksville, [Dade City](/septic-services-dade-city-fl/commercial-real-estate-septic-inspections/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, [**Orlando**](/septic-services-orlando-fl/commercial-real-estate-septic-inspections/), Plant City, Spring Hill, and [Tampa](/septic-services-tampa-fl/commercial-real-estate-septic-inspections/), Florida.* --- ### [Real Estate Sale Septic Inspections, Orlando, FL](https://southernsepticanddesign.com/septic-services-orlando-fl/real-estate-sale-septic-inspections/) **Published:** September 20, 2017 **Author:** Southern Water Soil **Content:** ## During real estate sale septic inspections in Orlando, we will fully assess the home’s septic system from tank to drain field. ![0Real Estate Sale Septic Inspections in Orlando, Florida](/wp-content/uploads/2017/09/Real-Estate-Sale-Septic-Inspections.jpg) As part of the home buying and selling process, it is very important not to neglect an inspection of a property’s septic system. At Southern Water and Soil, we know there are lots of details involved when readying a home for sale, and we also know that providing accurate documentation with a real estate sale septic inspection can be an important part of making a successful sale. If you are in the process of a real estate transaction, you’ll find our team at Southern Water and Soil is equipped to provide real estate sale septic inspections that will make your transaction go more smoothly in Orlando, Florida. Not only can we determine if a system is in good condition, but we can also make recommendations for maintenance if the system needs attention before closing. During **real estate sale septic inspections**, we will fully assess the home’s septic system from tank to drain field. We’ll provide a full report on the condition of the tank and other components, the expected lifespan of the system, and whether there are immediate repairs that need to be addressed. We also check the drain field to make sure it is not compromised and will continue to operate well. With our report, the buyer can choose to negotiate any necessary repairs and maintenance as part of the sale. At Southern Water and Soil, you can trust us to provide the septic services you require for all system types. [Contact us](/contact-southern-water-and-soil/) today to schedule **real estate sale septic inspections** for one or more properties in the Orlando area. ## [Commercial Real Estate Septic Inspections](https://southernsepticanddesign.com/septic-services-orlando-fl/commercial-real-estate-septic-inspections/) [![Septic Engineering in Spring Hill, Florida](https://southernsepticanddesign.com/wp-content/uploads/2017/09/septicengineer-100x100.jpg)](https://southernsepticanddesign.com/septic-services-orlando-fl/commercial-real-estate-septic-inspections/ "Commercial Real Estate Septic Inspections, Orlando, FL") Our commercial real estate septic inspections in Orlando include a full inspection of all septic components to ensure complete efficiency and effectiveness. If you are buying or selling a business with(…) [Read More](https://southernsepticanddesign.com/septic-services-orlando-fl/commercial-real-estate-septic-inspections/ "More About Commercial Real Estate Septic Inspections") --- *At Southern Water and Soil, we perform **real estate sale septic inspections** in Brooksville, Dade City, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, [**Orlando**](/septic-services-orlando-fl/real-estate-sale-septic-inspections/), Plant City, Spring Hill, and Tampa, Florida.* --- ### [Septic Tank Design, Tampa, FL](https://southernsepticanddesign.com/septic-services-tampa-fl/septic-tank-design/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Content:** ## When we perform septic tank design and installation in Tampa, FL, we will make sure that you feel informed throughout every step of the process. ![Septic Tank Design, Tampa, FL](/wp-content/uploads/2014/07/2012-11-13-14.34.51-300x168.jpg)When you consider the options for residential **septic tank design**, talk to our experts at Southern Water & Soil. We have engineers who can design a septic tank that works with what you need, whether you have a large property that needs drip irrigation options or if you just need a septic tank that can accommodate a single home. Most people hire experts to install the septic system, since the process involves specific steps to ensure that waste is treated and disposed of appropriately. In addition to having on-staff engineers, we also have licensed septic tank contractors who can make sure that your project is approved and meets local requirements before we begin installation. We will talk to you before we start, making sure that every aspect of the system you want is installed and is part of the job. We offer alternative septic tank design, as well as top brands of systems such as Geoflow, Hoot, Orenco, Norweco, No-Mound Systems, and more. When we begin the septic tank design process, we will use our knowledge and expertise to choose a system that will achieve the results you want for your commercial or residential property. When we perform **septic tank design** and installation, we will make sure that you feel informed throughout every step of the process. This ensures that you aren’t surprised by unexpected problems or additional costs. Our service area includes **Tampa, Florida**, as well as surrounding cities. We offer a variety of septic services, including pumping and cleaning, repair, routine maintenance, and more. [Contact us](/contact-southern-water-and-soil/ "septic systems experts") today for more details! --- *At Southern Water and Soil, we offer **septic tank design** services in Brooksville, [Dade City](/septic-services-brandon-fl/septic-tank-design/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/septic-services-odessa-fl/septic-tank-design/), Orlando, Plant City, Spring Hill, and **[Tampa](/septic-services-tampa-fl/septic-tank-design/)**, Florida.* --- ### [Commercial Septic Permit Application, Orlando, FL](https://southernsepticanddesign.com/commercial-septic-orlando-fl/commercial-septic-permits/commercial-septic-permit-application/) **Published:** September 20, 2017 **Author:** Southern Water Soil **Content:** ## Our team can help you complete the required paperwork for commercial septic permit application approval in Orlando. ![Commercial Septic Permit Application in Orlando, Florida](/wp-content/uploads/2017/09/commercialseptic-application.jpg) Are you adding a commercial septic system to your property in Orlando, Florida, but you need help getting started? At Southern Water and Soil, we are your first resource when you need assistance with your commercial septic permit application as you prepare to add a septic system to your commercial property. The first step in obtaining your **commercial septic permit application** is to visit your Florida Department of Health county office. They will be able to provide you with information about any state and county ordinances, as well as any important regulations you must follow before beginning the installation of your commercial septic system. Once your commercial septic permit application is obtained, our team at Southern Water and Soil can help you complete the required paperwork for approval. During this process, you will also need to submit a site plan, building floor plan, and the Florida Department of Health application fee. They will also ask that you schedule a site evaluation prior to the approval of your **commercial septic permit application**. The Florida Department of Health will then determine septic and construction requirements for your specific commercial property. At Southern Water and Soil, we know there are many details to manage as you plan to break ground on your new commercial location. Fortunately, we can direct you to the proper authorities, provide the necessary inspections, and ensure that your entire commercial septic installation goes as planned. Additional information about the requirements for your commercial septic permit application can also be found [on the Florida Department of Health website](/environmental-health/onsite-sewage/ostds-permitting.html). --- *At Southern Water and Soil, we can help with **commercial septic permit applications** in Brooksville, Dade City, Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, **[Orlando](/commercial-septic-orlando-fl/commercial-septic-permits/commercial-septic-permit-application/)**, Plant City, Spring Hill, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/commercial-septic-permit-application/), Florida.* --- ### [Commercial Septic Permits, Orlando, FL](https://southernsepticanddesign.com/commercial-septic-orlando-fl/commercial-septic-permits/) **Published:** September 20, 2017 **Author:** Southern Water Soil **Content:** ## We can help you obtain the necessary documentation and approval while requesting your commercial septic permits in Orlando. ![Commercial Septic Permits in Orlando, Florida](/wp-content/uploads/2017/09/commercial-septic-permits.jpg) When you are getting ready to break ground on a new business location, but you aren’t planning on being part of the city sewer system in Orlando, Florida, there is one very important step you must take: getting the proper **commercial septic permits** from the Florida Department of Health is a critical component of successful commercial septic installation. At Southern Water and Soil, we know there are many details to manage as you prepare your new business location, and your wastewater management system is certainly one of them. Fortunately, we are a trusted commercial septic company with more than 30 years of experience providing commercial septic services, and we are knowledgeable about the requirements for commercial septic permits. While residential and commercial septic systems are both designed to accommodate the amount of wastewater being processed at a location, commercial septic permits are different in that they apply to the type of business operation. For example, your commercial septic permits may need to detail whether your business will process any hazardous materials that need to be transferred with the proper disposal methods. Your **commercial septic permits** must also be obtained based on any jurisdictional requirements in the area in which you are planning to build. When you work with our experienced team, we can help you obtain the necessary documentation and approval while requesting your commercial septic permits in Orlando, and we will provide all of the necessary information to make your commercial septic installation a success. If you have questions about obtaining commercial septic permits in Orlando or you would like to work with us on your commercial septic installation in Orlando, [contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today. ## [Commercial Septic Permit Application](https://southernsepticanddesign.com/commercial-septic-orlando-fl/commercial-septic-permits/commercial-septic-permit-application/) [![Commercial Septic Permit Application in Dade City, Florida](https://southernsepticanddesign.com/wp-content/uploads/2017/09/commercialseptic-application-100x100.jpg)](https://southernsepticanddesign.com/commercial-septic-orlando-fl/commercial-septic-permits/commercial-septic-permit-application/ "Commercial Septic Permit Application, Orlando, FL") Our team can help you complete the required paperwork for commercial septic permit application approval in Orlando. Are you adding a commercial septic system to your property in Orlando, Florida, but(…) [Read More](https://southernsepticanddesign.com/commercial-septic-orlando-fl/commercial-septic-permits/commercial-septic-permit-application/ "More About Commercial Septic Permit Application") --- *At Southern Water and Soil, we can help you obtain **commercial septic permits** in Brooksville, [Dade City](/commercial-septic-brandon/commercial-septic-permits/), Fort Myers, [Land O’ Lakes](/commercial-septic-land-o-lakes-fl/commercial-septic-permits/), [Lutz](/commercial-septic-lutz-fl/commercial-septic-permits/), Miami, Odessa, [**Orlando**](/commercial-septic-orlando-fl/commercial-septic-permits/), Plant City, Spring Hill, or [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/), Florida.* --- ### [Commercial Septic Drain Field, Brandon, FL](https://southernsepticanddesign.com/commercial-septic-drain-field/) **Published:** April 9, 2018 **Author:** Southern Water Soil **Content:** ## Make sure your location’s drain field is in proper working order. ![Commercial Septic Drain Field in Brandon, Florida](/wp-content/uploads/2017/08/commercialseptic-drain-field.jpg) Commercial septic systems are highly intricate, especially when compared to their residential counterparts, and they use a combination of systems and equipment to run properly and efficiently. Before you install a new commercial septic system on your property, the big issue on your mind may be selecting the right tank for your facility. However, your **commercial septic drain field** plays a large role in the waste processing process and deserves careful consideration before installation. At Southern Water and Soil, we provide a number of commercial septic services in the Brandon, Florida area, and we can ensure the proper installation and production of your commercial septic drain field. Relying on our decades of experience in the industry, we will locate the right spot for your drain field and determine how to lay the pipes to ensure wastewater efficiently makes its way to this area after leaving the septic tank. To ensure your septic system continues to work as it should, make sure your **commercial septic drain field** continues to receive proper care. Our team can help you with this and devise a comprehensive maintenance plan that ensures your business’ location is never without septic service. For further information about installing a new commercial septic drain field or maintaining a current one, please [reach out to us](/contact-southern-water-and-soil/) at Southern Water and Soil today. From our business to your business, we are committed to providing superior customer service, reliable solutions, and competitive rates. --- ### [Specials](https://southernsepticanddesign.com/specials/) **Published:** January 21, 2015 **Author:** Southern Water Soil **Content:** Thanks for visiting our website! We’re promoting specials on some of our septic services on this page. Please check back later if you can’t find something you like. --- ### [Commercial Septic System Repair, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-tampa-fl/commercial-septic-system-repair/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Content:** ## Our commercial septic system repair experts in Tampa, FL can offer recommendations for repairs or tell you when you need to have a new tank installed. ![Septic Engineering](/wp-content/uploads/2014/07/2013-07-03-13.07.14-300x168.jpg)If your business is located in a rural area, it will require a septic system to process waste and liquid that comes out of the building. Septic tanks offer a self-contained way to process and move waste out of the pipes from sinks, toilets, and any other drains. Every aspect of your septic system performs an important role, so **commercial septic system repair** should only be done by an expert. At Southern Water & Soil, we offer this service to businesses in and around Tampa, Florida. If any part of your septic system is not working, it can throw off the whole process, leading to leaks or backup of pipes, so call us right away. We offer emergency service throughout the Tampa area. There are two major kinds of septic systems: alternative and gravity-based. Alternative systems use a pump to push the liquid through the system, so watch for signs that the pump is weakening or going out, since this can cause the system to back up. Our commercial septic system repair experts can offer recommendations for repairs or tell you when you need to have a new tank installed. If your business produces a high volume of water or waste, a commercial tank that can hold more may be a better option. At Southern Water & Soil, our list of services includes **commercial septic system repair**, septic tank cleaning and pumping, and septic tank replacement. We also offer routine maintenance contracts, which can help prevent bigger problems down the road. [Contact us](/contact-southern-water-and-soil/ "commercial septic systems experts") today for more information. --- ### [Septic System Warranty Packages, Brandon, FL](https://southernsepticanddesign.com/septic-system-warranty-packages/) **Published:** June 6, 2017 **Author:** Southern Water Soil **Content:** ## Our septic system warranty packages vary are a cost-effective way to ensure you get great results from your septic installation in Brandon. ![Septic System Warranty Packages in Brandon, Florida](/wp-content/uploads/2017/06/septicsystemwarrantypackages.jpg) At Southern Water and Soil, we understand that your septic system is an investment and you expect it to work efficiently from day one after installation. Fortunately, we offer the services and solutions you need to get the best results. Whether you need new installation of a residential system or you are replacing your commercial septic system with something more efficient, you won’t be disappointed with our workmanship and quality services at Southern Water and Soil. One of the ways we ensure that our customers in Brandon, Florida have peace of mind before, during, and after their septic system installation is with our **septic system warranty packages.** While each of our septic system warranty packages varies depending upon the system type you choose, they will most certainly give you the added security you need to avoid unexpected costs due to system malfunctions or unexpected concerns. At Southern Water and Soil, we do everything we can to help you achieve the most efficient septic system possible for your home or business, and with our septic system warranty packages, you can’t go wrong. Our highly cross-trained team is made up of skilled designers, engineers, and septic professionals available to ensure that you truly get the best results. If you have questions about septic system installation, are looking for maintenance solutions, or would like to inquire about our **septic system warranty packages,** [contact us](/contact-southern-water-and-soil/) today to learn more. We will always work to exceed your expectations, provide cost-effective solutions, and leave you with an excellent septic system that works efficiently for the long term. --- *At Southern Water and Soil, we offer **septic system warranty packages** in [Tampa](/septic-systems-tampa-fl/septic-system-warranty-packages), [, Lutz, [Land O’ Lakes](/septic-systems-land-o-lakes-fl/septic-system-warranty-packages/), **[Brandon](/septic-systems-brandon-fl/septic-system-warranty-packages/)**, Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.](/septic-systems-odessa-fl/septic-system-warranty-packages/)* --- ### [Aerobic Septic Systems, Lutz, FL](https://southernsepticanddesign.com/aerobic-septic-systems/) **Published:** March 22, 2016 **Author:** Southern Water Soil **Content:** ## Many Lutz, FL home and business owners are going with aerobic septic systems. Call us today for more information! ![Aerobic Septic Systems](/wp-content/uploads/2015/09/2012-11-20-12.45-resize-300x169.jpg)There are many different kinds of septic systems out there, but one of the most popular options is the aerobic septic system. These septic systems are popular for use in both residential and commercial applications throughout Lutz, FL because they are self-contained and highly efficient. If you are thinking about having one of these systems installed, be sure to contact us at Southern Water and Soil. Aerobic septic systems consist of a large, self-contained unit where most of the waste processing happens. Wastewater starts by flowing through the pipes into a pre-cast concrete septic tank, where the waste is pre-treated to start the process of separation. This tank contains special bacteria that help to separate waste from water, allowing the water to flow into the drain field for further separation. In order to ensure that the aerobic septic systems work properly, they need to be installed correctly. That is where our team at Southern Water and Soil comes in. We have many years of experience in the septic industry, so you can count on us to get the job done right. We not only sell some of the most popular aerobic septic systems produced by Norweco, but we also offer septic system installation services. When it comes to septic systems for your Lutz, FL home or business, you have a variety of options. No matter which option you select, you can count on us to design and install it for you. Just give us a call at Southern Water and Soil for a free quote, and we will be happy to answer your questions about aerobic septic systems and schedule you an appointment. We are the best in the business, so you know that you will be happy if you work with us. --- *At Southern Water and Soil, we install **aerobic septic systems** in [Tampa](/septic-systems-tampa-fl/aerobic-septic-systems), [Odessa](/septic-systems-odessa-fl/aerobic-septic-systems/), **[Lutz](/septic-systems-lutz-fl/aerobic-septic-systems/)**, [Land O’ Lakes](/septic-systems-land-o-lakes-fl/aerobic-septic-systems/), Brandon, Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Septic System Design, Brandon, FL](https://southernsepticanddesign.com/septic-system-design/) **Published:** July 26, 2017 **Author:** Southern Water Soil **Content:** ## Our team has over three decades of experience providing septic system design services in Brandon. ![Septic System Design in Brandon, Florida](/wp-content/uploads/2017/07/2011-08-01-15.57.40-resized.jpg) At Southern Water and Soil, we cannot emphasize enough the importance of a well-designed septic system for your home or business in Brandon, Florida. There are lots of things to take into consideration, whether you require a replacement part or a new installation, so your septic system works its best. Fortunately, our team has over three decades of experience providing **septic system design** services and solutions for our customers, and you can rely on us to ensure that you have a low-maintenance, high-efficiency system. With septic system design, not only do you need to consider the size of your property and the number of people using the plumbing each day, but you also need to consider the property layout and the type of septic system that will work best for your needs. At Southern Water and Soil, we can assist with septic system design, whether you need a traditional system installed or you are interested in a performance-based or decentralized wastewater system. We’ll always take a unique approach to your **septic system design** because no two properties are alike! You can always feel confident that you are going to have a septic system that is designed to work well and last for many years to come. If you have questions about our septic system design services or you need to schedule an estimate for your property, contact us at Southern Water and Soil today. We also offer septic system installation, repairs and maintenance to meet your needs. We look forward to working with you. --- *At Southern Water and Soil, we offer **septic system design** services in [Tampa](/septic-systems-tampa-fl/septic-system-design/), [Odessa](/septic-systems-odessa-fl/septic-system-design/), [Lutz](/septic-systems-lutz-fl/septic-system-design/), [Land O’ Lakes](/septic-systems-land-o-lakes-fl/septic-system-design/), **[Brandon](/septic-systems-brandon-fl/septic-system-design/)**, Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Septic System Design, Land O’ Lakes, FL](https://southernsepticanddesign.com/septic-system-design/) **Published:** June 8, 2016 **Author:** Southern Water Soil **Content:** ## Our team can assist you with septic system design for your home or commercial business in Land O’ Lakes. ![Septic System Design in Land O’ Lakes, Florida](/wp-content/uploads/2014/07/2011-08-01-15.57.40-300x179.jpg)The right septic contractor can provide a lot of helpful information about **septic system design**. Whether you are building a new home or need assistance with replacement or repair of an existing component, a septic contractor has the knowledge and experience you need. At Southern Water and Soil, our team has been working with clients for over 30 years and can assist you with septic system design for your home or commercial business. If you are looking to install a new septic system on your property, we can help with the process from start to finish. Without the right septic system design, you may end up with a tank that is too small or an installation that is set up to fail. It is important to keep your system working correctly, so you can enjoy low maintenance and a long lifeline for your septic system. Our septic contractors will oversee everything from septic system design to installation to ensure you get the most from your system. The plumbing is also crucial to move the water and waste from the drains and into the tank, so we will make sure the pipes can accommodate the water coming from your home or business. Our team at Southern Water and Soil offers a full range of septic services, including new septic installations, repairs, and maintenance in Land O’ Lakes, Florida. When you rely on us to take care of your **septic system design** needs, you can rest easy that the job is done right. [Contact us](/contact-southern-water-and-soil/) today to get started. --- *At Southern Water and Soil, we offer **septic system design** services in [Tampa](/septic-systems-tampa-fl/septic-system-design/), [Odessa](/septic-systems-odessa-fl/septic-system-design/), [Lutz](/septic-systems-lutz-fl/septic-system-design/), **[Land O’ Lakes](/septic-systems-land-o-lakes-fl/septic-system-design/)**, [Brandon](/septic-systems-brandon-fl/septic-system-design/), Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Septic System Design, Lutz, FL](https://southernsepticanddesign.com/septic-system-design/) **Published:** May 5, 2016 **Author:** Southern Water Soil **Content:** ## During all parts of the septic system design process in Lutz, FL, our team will ensure that you are informed about what is occurring. ![Septic System Design, Lutz, FL](/wp-content/uploads/2016/05/2015-08-18-14.32.15-300x169.jpg)The options available for **septic system design** can be overwhelming at best. Whether you need a septic system that can accommodate a single-family home or you need to explore the idea of installing a modular system that will serve a commercial location, our experts at Southern Water and Soil want to guide you and assist you with all aspects of the septic system design process. Our highly proficient engineers will ensure that the design of your septic tank meets local and state requirements and that all permitting is managed efficiently and properly. Please keep in mind that while we have completed many standard septic system designs, we are also capable of designing alternative systems. Additionally, we work with many leading brands, including Norweco, Orenco, Hoot, and Geoflow. Whatever your needs, you can rest assured that we will design a system for you that meets the specific wastewater and collection needs of your property in **Lutz, Florida**. During all parts of the septic system design process, our team will ensure that you are informed about what is occurring. We want to make sure you are never surprised by unexpected problems, additional costs, or the timeframe of the design process. We promise we will be extremely transparent about what is occurring and provide you with timely updates. [Contact us](/contact-southern-water-and-soil/) at Southern Water and Soil today to find out more about the **septic system design** process and our impressive capabilities. We look forward to putting our knowledge and expertise of the septic industry to work for you. --- *At Southern Water and Soil, we offer **septic system design** services in [Tampa](/septic-systems-tampa-fl/septic-system-design/), [Odessa](/septic-systems-odessa-fl/septic-system-design/), **[Lutz](/septic-systems-lutz-fl/septic-system-design/)**, [Land O’ Lakes](/septic-systems-land-o-lakes-fl/septic-system-design/), [Brandon](/septic-systems-brandon-fl/septic-system-design/), Orlando, Plant City, Dade City, Bartow, Lake Wales, and Lakeland, Florida.* --- ### [Commercial Septic Pumping, Tampa, FL](https://southernsepticanddesign.com/commercial-septic-pumping/) **Published:** July 2, 2014 **Author:** Southern Water Soil **Content:** ## Give us a call today for your commercial septic pumping needs in Tampa, FL! ![Commercial Septic Pumping](/wp-content/uploads/2014/07/2012-01-18-13.31.18-300x179.jpg)One of the many services that we offer at Southern Water & Soil is commercial septic pumping. We pride ourselves on taking the process a step further by offering education and increasing awareness about how your commercial system works and making sure you understand what problems to watch for to prevent backup and other issues. During the **commercial septic pumping** process, we also offer cleaning services that can remove sludge and bad bacteria from the tank, promoting a cleaner and healthier atmosphere for waste processing. While we clean and pump, our team will also perform a basic inspection to make sure each component of the system is doing its job and to check for any possible cracks, leaks, or other problems. One of the key benefits of routine maintenance, which includes commercial septic pumping, cleaning, and inspection, is that when we do see a possible problem, we can fix it then instead of waiting for it to cause a sewage leak or other messy issue. We also offer customized maintenance contracts, which allows our team to come out during a regularly scheduled appointment, ensuring that you don’t have to worry about trying to keep the pumping process on schedule. We will take care of that for you! We offer **commercial septic pumping**, along with various other septic services for commercial and residential properties, in Tampa, Florida. We can repair or pump most brands of systems, whether or not we installed the system. We have a lot of experience with a variety of septic system designs, so give us a call today for your commercial septic pumping needs. --- ### [Residential Septic, Lutz, FL](https://southernsepticanddesign.com/residential-septic-lutz-fl/) **Published:** July 30, 2026 **Author:** Southern Water Soil **Content:** ### Similar Services We Offer: --- ### [Distributed Wastewater Treatment Units, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-units/) **Published:** June 22, 2026 **Author:** Southern Water Soil **Content:** ## We offer professional design and installation of distributed wastewater treatment units. At Southern Water and Soil, we provide professional design and installation services for **distributed wastewater treatment units**, offering dependable wastewater management solutions for properties without access to municipal sewer systems. These systems are a practical option for many types of properties, including subdivisions, mobile home parks, and other multi-user developments here in the **Spring Hill, Florida** area. ![Distributed Wastewater Treatment Units in Spring Hill, Florida](/wp-content/uploads/2025/06/20220303_154759-res.jpg) Distributed wastewater treatment units are engineered to treat and manage wastewater at or near the point of generation using a network of smaller, interconnected systems. Unlike a traditional single septic tank, these systems are scalable and can be customized to handle varying wastewater volumes, depending on the demands of the site. Our team designs every system based on site-specific factors, such as soil conditions, projected flow rates, and property layout. Our process begins with a comprehensive site evaluation and soil testing. From there, we develop a detailed system design that meets all local and state code requirements. Our licensed installers then handle every aspect of construction, from excavation to final system startup. Regulatory compliance is critical for distributed wastewater treatment system projects. We coordinate closely with local health departments and permitting agencies to make sure all applications, designs, and installations are fully approved before construction begins. Our experience working with regulators means fewer delays and a smoother process for our clients. If you are planning a development or upgrading an existing wastewater system, we have the expertise to deliver a dependable distributed wastewater treatment unit tailored to your property’s specific needs. [Contact us today](/contact-southern-water-and-soil/) to schedule a site visit to discuss your project and learn more about our work with **distributed wastewater treatment units**. --- *At Southern Water and Soil, we offer **distributed wastewater treatment units** in Brooksville, [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-units/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-units/)**, and Tampa, Florida.* --- ### [Distributed Wastewater Treatment Unit Designs, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-unit-designs/) **Published:** June 22, 2026 **Author:** Southern Water Soil **Content:** ## We put together effective distributed wastewater treatment unit designs. At Southern Water and Soil, we are a well-known residential septic designer and installer here in the **Spring Hill, Florida** area. Over the years, we have seen an uptick in the demand for **distributed wastewater treatment unit designs**, especially in areas lacking centralized sewer infrastructure. ![Distributed Wastewater Treatment Unit Designs in Spring Hill, Florida](/wp-content/uploads/2025/06/20150214_090751-res.jpg) These systems boast flexible, site-specific wastewater solutions that are ideal for residential developments, rural properties, and smaller communities. One of the things that sets distributed wastewater treatment units apart is that they can handle varying flow rates and challenging site conditions, such as high groundwater, poor soil percolation, or limited space, all while providing reliable treatment performance. When working on distributed wastewater treatment unit designs, we start with a thorough site assessment, which includes soil tests, surveys, and evaluating the available space for a drain field, a tank, or alternative dispersal methods. Depending on the constraints of the site, we might use an advanced treatment unit, such as an aerobic treatment system. From an installation standpoint, distributed wastewater treatment units can often reduce trenching and piping requirements, saving money on labor and materials. Some modular systems can be set up quickly and with minimal disturbance to the property. We also prioritize ease of access for service and maintenance, which are important factors for both homeowners and service providers. A well-designed distributed wastewater treatment unit means fewer headaches, predictable performance, and compliance with local codes. [Contact us today](/contact-southern-water-and-soil/) to learn more about the **distributed wastewater treatment unit designs** we put together. --- *At Southern Water and Soil, we offer **distributed wastewater treatment unit designs** in Brooksville, [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-unit-designs/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-unit-designs/)**, and Tampa, Florida.* --- ### [Distributed Wastewater Treatment System Permits, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/distributed-wastewater-treatment-system-permits/) **Published:** June 22, 2026 **Author:** Southern Water Soil **Content:** ## We can acquire the permits needed for distributed wastewater system installations. Designing and engineering high-performance septic systems is what we do here at Southern Water and Soil. We specialize in designing and installing distributed wastewater treatment systems, which are ideal for developments where centralized sewer access is unavailable or impractical. Whether you are managing a multi-unit residential site or a small community, a properly designed distributed wastewater treatment system offers a reliable wastewater solution. ![Distributed Wastewater Treatment System Permits in Spring Hill, Florida](/wp-content/uploads/2025/06/20140109_112304-res.jpg) Permitting is one of the most important steps in any distributed wastewater treatment system project. Our team works closely with property owners, engineers, and local regulatory agencies to ensure every system we install here in the **Spring Hill, Florida** area meets applicable permitting requirements. These permits typically involve detailed site evaluations, soil testing, system design reviews, and compliance with local and state health codes. In most cases, distributed systems must also meet specific performance standards, monitoring protocols, and reporting requirements. We handle the entire process for acquiring **distributed wastewater treatment system permits** on your behalf. From preparing the necessary documentation to submitting applications and coordinating with inspectors, we will put our years of experience navigating state and county regulations to work for you. This way, your project stays on track and in compliance from day one. When it comes to distributed wastewater treatment system permits, we can answer any of your questions and help with all phases of the permitting process for a successful project. For more information about **distributed wastewater treatment system permits** or to start your project, [get in touch with us today](/contact-southern-water-and-soil/). --- *At Southern Water and Soil, we handle the entire process for acquiring **distributed wastewater treatment system permits** in Brooksville, [Dade City](/commercial-septic-dade-city-fl/distributed-wastewater-treatment-systems/distributed-wastewater-treatment-system-permits/), Fort Myers, Land O’ Lakes, Lutz, Miami, Odessa, Orlando, Plant City, Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/distributed-wastewater-treatment-systems/distributed-wastewater-treatment-system-permits/)**, and Tampa, Florida.* --- ### [Commercial Septic Permit Application, Spring Hill, FL](https://southernsepticanddesign.com/commercial-septic-spring-hill-fl/commercial-septic-permits/commercial-septic-permit-application/) **Published:** June 22, 2026 **Author:** Southern Water Soil **Content:** ## We can help you acquire the necessary permits for your new commercial septic system. ![Commercial Septic Permit Application in Spring Hill, Florida](/wp-content/uploads/2017/09/commercialseptic-application.jpg)If you’re breaking ground on a new commercial facility here in the **Spring Hill, Florida** area, it’s crucial to get your **commercial septic permit application** submitted as soon as possible. By the time your building is ready to open its doors to the public, you’ll want to ensure that your wastewater treatment system is operating safely, reliably, and efficiently. Fortunately, our dedicated local team at Southern Water and Soil is here to help you through each step of the commercial septic permit application process. With over 30 years of combined experience in the septic industry, our professionals are deeply familiar with the local laws, regulations, and permit requirements throughout this area. We’re more than ready to answer any questions you may have, assess your property, and help you through the application process. We have helped countless business owners fill out and submit commercial septic permit applications over the years, and we’re confident that we can give you the information you need in no time. Once we help you fill out your commercial septic permit application, we can work with you to design and install your new system as soon as your application is approved. Our team will thoroughly inspect your landscape and come up with an efficient and reliable system that will be able to reliably manage your typical wastewater processing needs. We’ll ask you about your company’s water usage habits, how many people will be in your building during peak hours, and other information to ensure that we customize the ideal solution for you. If you have questions about the **commercial septic permit application** process, know that you don’t need to struggle through it alone. Instead, you can turn to us to get the friendly, professional support you deserve. [Contact us today](/contact-southern-water-and-soil/) to get started! --- *At Southern Water and Soil, we can help with **commercial septic permit applications** in Brooksville, [Dade City](/commercial-septic-dade-city-fl/commercial-septic-permits/commercial-septic-permit-application/), Fort Myers, Land O’ Lakes, Lutz, Miami, [Odessa](/commercial-septic-odessa-fl/commercial-septic-permits/commercial-septic-permit-application/), Orlando, Plant City, Wesley Chapel, **[Spring Hill](/commercial-septic-spring-hill-fl/commercial-septic-permits/commercial-septic-permit-application/)**, and [Tampa](/commercial-septic-tampa-fl/commercial-septic-permits/commercial-septic-permit-application/), Florida.* --- ## Categories ### [Septic Services Blog](https://southernsepticanddesign.com/category/septic-services-blog/) **Description:** Check out our blog to learn more about our septic servicesAt Southern Water and Soil, we are your source for high-quality, comprehensive septic design and engineering services here in Florida. If you need to design and engineer a septic system for your property, we are the company to turn to. We want to tell you more about our services before you start your project, and our blog is a great starting point. Start here to learn more about our processes, our services, and what working with us is like. And of course, if you have any questions, feel free to reach out to us directly. --- ## Tags ### [septic drain field](https://southernsepticanddesign.com/tag/septic-drain-field/) --- ### [septic systems](https://southernsepticanddesign.com/tag/septic-systems/) --- ### [septic system design](https://southernsepticanddesign.com/tag/septic-system-design/) --- ### [aerobic septic systems](https://southernsepticanddesign.com/tag/aerobic-septic-systems/) --- ### [septic pumping](https://southernsepticanddesign.com/tag/septic-pumping/) --- ### [septic services](https://southernsepticanddesign.com/tag/septic-services/) --- ### [septic tank installations](https://southernsepticanddesign.com/tag/septic-tank-installations/) --- ### [septic system repair](https://southernsepticanddesign.com/tag/septic-system-repair/) --- ### [septic tank design](https://southernsepticanddesign.com/tag/septic-tank-design/) --- ### [septic permit application](https://southernsepticanddesign.com/tag/septic-permit-application/) --- ### [Septic Engineering](https://southernsepticanddesign.com/tag/septic-engineering/) --- ### [Septic System Warranty Packages](https://southernsepticanddesign.com/tag/septic-system-warranty-packages/) --- ### [Residential Septic System Design](https://southernsepticanddesign.com/tag/residential-septic-system-design/) --- ### [Commercial Septic Systems](https://southernsepticanddesign.com/tag/commercial-septic-systems/) --- ### [Septic System](https://southernsepticanddesign.com/tag/septic-system/) --- ### [Septic](https://southernsepticanddesign.com/tag/septic/) --- ### [Septic Repair](https://southernsepticanddesign.com/tag/septic-repair/) --- ### [Septic Tank Pumping](https://southernsepticanddesign.com/tag/septic-tank-pumping/) --- ### [Commercial Septic Permit Application](https://southernsepticanddesign.com/tag/commercial-septic-permit-application/) --- ### [Commercial Septic Tank Installation](https://southernsepticanddesign.com/tag/commercial-septic-tank-installation/) --- ### [Drip Irrigation System Installation](https://southernsepticanddesign.com/tag/drip-irrigation-system-installation/) --- ### [Drain Field Options](https://southernsepticanddesign.com/tag/drain-field-options/) --- ### [Drain Field Design](https://southernsepticanddesign.com/tag/drain-field-design/) --- ### [Cluster Wastewater Treatment](https://southernsepticanddesign.com/tag/cluster-wastewater-treatment/) --- ### [Septic Alarms](https://southernsepticanddesign.com/tag/septic-alarms/) --- ### [septic system inspections](https://southernsepticanddesign.com/tag/septic-system-inspections/) --- ### [Commercial Septic Drain Field](https://southernsepticanddesign.com/tag/commercial-septic-drain-field/) --- ### [Commercial Septic System Maintenance](https://southernsepticanddesign.com/tag/commercial-septic-system-maintenance/) --- ### [Commercial Real Estate Septic Inspections](https://southernsepticanddesign.com/tag/commercial-real-estate-septic-inspections/) --- ### [Commercial Septic](https://southernsepticanddesign.com/tag/commercial-septic/) --- ### [Commercial Septic System Design](https://southernsepticanddesign.com/tag/commercial-septic-system-design/) --- ### [Septic Tank Repair](https://southernsepticanddesign.com/tag/septic-tank-repair/) --- ### [Package Plant Installations](https://southernsepticanddesign.com/tag/package-plant-installations/) --- ### [Commercial Septic Services](https://southernsepticanddesign.com/tag/commercial-septic-services/) --- ### [Engineered Drip Septic Systems](https://southernsepticanddesign.com/tag/engineered-drip-septic-systems/) --- ### [Commercial Septic System Engineering](https://southernsepticanddesign.com/tag/commercial-septic-system-engineering/) --- ### [Commercial Septic Permits](https://southernsepticanddesign.com/tag/commercial-septic-permits/) --- ### [Commercial Septic Tank Repair](https://southernsepticanddesign.com/tag/commercial-septic-tank-repair/) --- ### [Commercial Septic Company](https://southernsepticanddesign.com/tag/commercial-septic-company/) --- ### [Passive nitrogen septic systems](https://southernsepticanddesign.com/tag/passive-nitrogen-septic-systems/) --- ### [Orenco AdvanTex AX-Max](https://southernsepticanddesign.com/tag/orenco-advantex-ax-max/) --- ### [Septic to Sewer Commercial Corridors Program](https://southernsepticanddesign.com/tag/septic-to-sewer-commercial-corridors-program/) --- ### [NSF 245 Septic Systems](https://southernsepticanddesign.com/tag/nsf-245-septic-systems/) --- ### [BMAP](https://southernsepticanddesign.com/tag/bmap/) --- ### [Distributed Wastewater Treatment Systems](https://southernsepticanddesign.com/tag/distributed-wastewater-treatment-systems/) --- ## Stats Types ### [view](https://southernsepticanddesign.com/wpa-stats-type/view/) --- ### [Chrome](https://southernsepticanddesign.com/wpa-stats-type/chrome/) --- ### [Android](https://southernsepticanddesign.com/wpa-stats-type/android/) --- ### [Safari](https://southernsepticanddesign.com/wpa-stats-type/safari/) --- ### [iPhone](https://southernsepticanddesign.com/wpa-stats-type/iphone/) --- ### [unknown](https://southernsepticanddesign.com/wpa-stats-type/unknown/) --- ### [Windows](https://southernsepticanddesign.com/wpa-stats-type/windows/) --- ### [Macintosh](https://southernsepticanddesign.com/wpa-stats-type/macintosh/) --- ### [Linux](https://southernsepticanddesign.com/wpa-stats-type/linux/) --- ### [Samsung Browser](https://southernsepticanddesign.com/wpa-stats-type/samsung-browser/) --- ### [Firefox](https://southernsepticanddesign.com/wpa-stats-type/firefox/) ---